KEGG   Lactobacillus fermentum IFO 3956: LAF_0989Help
Entry
LAF_0989          CDS       T00699                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00071  Fatty acid degradation
lfe00072  Synthesis and degradation of ketone bodies
lfe00280  Valine, leucine and isoleucine degradation
lfe00310  Lysine degradation
lfe00362  Benzoate degradation
lfe00380  Tryptophan metabolism
lfe00620  Pyruvate metabolism
lfe00630  Glyoxylate and dicarboxylate metabolism
lfe00640  Propanoate metabolism
lfe00650  Butanoate metabolism
lfe00900  Terpenoid backbone biosynthesis
lfe01100  Metabolic pathways
lfe01110  Biosynthesis of secondary metabolites
lfe01120  Microbial metabolism in diverse environments
lfe01130  Biosynthesis of antibiotics
lfe01200  Carbon metabolism
lfe01212  Fatty acid metabolism
lfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LAF_0989
   00630 Glyoxylate and dicarboxylate metabolism
    LAF_0989
   00640 Propanoate metabolism
    LAF_0989
   00650 Butanoate metabolism
    LAF_0989
  Lipid metabolism
   00071 Fatty acid degradation
    LAF_0989
   00072 Synthesis and degradation of ketone bodies
    LAF_0989
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LAF_0989
   00310 Lysine degradation
    LAF_0989
   00380 Tryptophan metabolism
    LAF_0989
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAF_0989
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LAF_0989
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LAF_0989
Enzymes [BR:lfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LAF_0989
Exosome [BR:lfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LAF_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III MelC1
Motif
Other DBs
NCBI-ProteinID: BAG27325
UniProt: B2GCE3
Position
1142171..1143343
Genome map
AA seq 390 aa AA seqDB search
MEKVVFVGAARTPIGKLGGALATLTAAQLGTIAIQAALERAAVAPEEVNEVYLGCAIQAG
QGQNVARQASIAAGLPVTVPATTVNVMCGSGMHAVNLAAKLIAMGDAEVMVAGGTESMST
APYLMPKGRFGYKYGNAELVDALYKDGLEDAFFHYPMGCTAENLVEKYQVTREDLDHFAL
QSQVRARTAQDAGRFKDEIVPVTVKGKRHQLEVTEDEAIRDTTMEKLAALKPVFKEGGDV
TAGNSSGLNDGAAALILMSERRALAEGKEILGYWQAGTLAGVKPELMGIGPLAATKKLLA
QVDMTPDQLDLIEINEAFAAQAIVCQRELGFEESKVNVNGGAIALGHPLGDSGARILVTL
LYQMKRQNAKRGLGTLCIGGGMGAATLVYR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgttttcgttggagctgcacggacgccgattggaaagctcggtggcgcc
ctggccacactgaccgctgcccagttgggaacaattgccatccaggccgccttagagcgg
gccgcggttgctcccgaagaagtgaatgaggtctacctgggctgcgccatccaggccggc
caggggcaaaacgtcgcccgccaggccagcattgccgccgggttgccggttaccgttccg
gccaccaccgttaacgtgatgtgtggctccggaatgcacgccgttaacctagcggccaag
ctgattgccatgggggacgccgaagtgatggtggcggggggcaccgaaagcatgtcgacg
gccccgtatttgatgcccaagggccgctttggttacaagtacggtaacgccgaactggtc
gacgccctgtataaggacgggttggaagacgccttcttccactacccaatgggttgcacg
gccgaaaacctggtcgaaaaataccaggtgactagagaagacctcgaccacttcgccctg
caaagccaagtgcgggcacggacggcgcaagacgcggggcgttttaaagacgaaatcgtg
ccggtgaccgtcaagggcaagcgccaccaacttgaagttacagaagacgaggcgattcgc
gacacgacgatggaaaaattagcggccttaaagccggtctttaaagaaggtggcgacgtg
acggccggcaattcttccggattaaatgacggcgccgctgctttaatcctaatgagcgaa
cgccgggctctggcggaaggcaaggaaattctcggctactggcaggccggtaccttggcc
ggggtcaagccggaactcatggggatcggccccttggcggccaccaagaagctgctcgcc
caggttgacatgacgcccgaccagcttgacctgatcgaaattaacgaagcctttgccgcc
caagcgatcgtttgccagcgcgaattgggcttcgaggagagcaaggtgaacgtcaacggt
ggggcaattgcccttggtcatcccctgggcgactccggggcccgcattttggtgacccta
ctctaccaaatgaagcgccaaaacgccaagcgggggctggggaccctgtgcattggcggc
gggatgggcgctgccaccctcgtctaccgttag

DBGET integrated database retrieval system