KEGG   Lactobacillus fermentum IFO 3956: LAF_1138Help
Entry
LAF_1138          CDS       T00699                                 

Definition
(GenBank) pyruvate dehydrogenase complex E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00010  Glycolysis / Gluconeogenesis
lfe00020  Citrate cycle (TCA cycle)
lfe00620  Pyruvate metabolism
lfe01100  Metabolic pathways
lfe01110  Biosynthesis of secondary metabolites
lfe01120  Microbial metabolism in diverse environments
lfe01130  Biosynthesis of antibiotics
lfe01200  Carbon metabolism
Module
lfe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAF_1138
   00020 Citrate cycle (TCA cycle)
    LAF_1138
   00620 Pyruvate metabolism
    LAF_1138
Enzymes [BR:lfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LAF_1138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAG27474
UniProt: B2GCU2
Position
complement(1312919..1314208)
Genome map
AA seq 429 aa AA seqDB search
MSKYQFKLPELGEGMVEGTVGEWHVKEGDHIAKDADLVNIENDKSSEDLPSPVDGTITKI
LVQEDETAELGDPLVEIEVADGEGNVEDDGAAEAPAAEEAPAATPAPAAPAAAGAAPAEA
DHSVPVLAMPAVRKYAREKGVDLHQVTGTGRHGQILKADVDAFNGAAPAATEAPAATEAP
APAPVAAAPAPAAAEGWPEHAEKMSKIRKATAKAMTTAKDQIPMITVFDDVVVDKLWDHR
KKFKQLAADRGTHLTFMAYMTKALAVIMREFPVFNSKVDMENKQINYRDYINVGIATDTD
NGLFVPNVKHADRLSLFGIADAISENTAKAKDGKLSAADMSNTGMTITNIGSIGGGHFTP
IVNWPEVAIIGMGKISQEPIVVDDHIEPAKVLKLSLTVDHRVIDGATAQRAMNRMKELLG
DPELLLMEG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaataccaattcaagttaccagaacttggtgaagggatggtcgaagggactgtc
ggcgagtggcacgttaaggaaggtgaccacatcgcaaaggatgctgacctggttaacatc
gaaaacgacaagtcctcagaagatcttccgtcaccggttgatggtacgattacgaagatt
ttagttcaagaagacgaaacagcagaactcggtgacccactggttgaaatcgaagttgct
gacggtgaaggtaacgttgaagacgacggtgccgctgaagctccggccgctgaagaagca
cctgctgcaacgcctgctccggccgctccagccgctgcgggtgctgctcctgctgaagca
gaccactccgttccggttctggcgatgccagccgttcgtaagtacgctcgtgaaaagggc
gttgacttacaccaagttacggggactggccgtcacggtcaaatcttgaaggctgacgtt
gacgccttcaacggcgctgctccggctgctactgaagccccagccgctaccgaagctccg
gcaccagcaccagttgctgctgccccagctccggctgccgcagaaggttggccagaacat
gctgaaaagatgagcaaaattcgcaaggccactgctaaggcaatgacgactgctaaggac
caaatcccaatgatcactgtctttgacgacgtggttgttgacaagctttgggaccaccgc
aagaagttcaagcaactggctgctgaccgcgggactcacctgaccttcatggcttacatg
accaaggctttagcagtgattatgcgcgaattccctgtcttcaactccaaggttgacatg
gaaaacaagcaaattaactaccgtgactacattaacgttgggatcgccactgacaccgac
aacggtctctttgttccgaacgttaagcacgctgaccgtttgagcctcttcggtattgct
gacgctattagtgaaaacaccgctaaggctaaggacggcaagctcagtgctgctgacatg
agcaacactgggatgacgattactaacattggttccattggtgggggtcacttcacgcca
atcgttaactggccagaagttgccatcatcgggatggggaagatctcccaagaaccgatc
gttgtggacgaccacatcgaaccagctaaggtgctgaagctttccctgactgttgaccac
cgggtaatcgacggggcaaccgctcaacgggcaatgaaccggatgaaggaactgcttggt
gacccagaattactgttaatggagggataa

DBGET integrated database retrieval system