KEGG   Lactobacillus fermentum F-6: LBFF_0061Help
Entry
LBFF_0061         CDS       T02669                                 

Definition
(GenBank) D-alanine-poly(Phosphoribitol) ligase, subunit 2
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
lff  Lactobacillus fermentum F-6
Pathway
lff00473  D-Alanine metabolism
lff01100  Metabolic pathways
lff01503  Cationic antimicrobial peptide (CAMP) resistance
lff02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lff00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LBFF_0061
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBFF_0061
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LBFF_0061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lff01504]
    LBFF_0061
Enzymes [BR:lff01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LBFF_0061
Antimicrobial resistance genes [BR:lff01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LBFF_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding PP-binding_2
Motif
Other DBs
NCBI-ProteinID: AGL87983
Position
complement(74752..74988)
Genome map
AA seq 78 aa AA seqDB search
MIEKIQELLAQATGRDAADFADADENLFDSGLIDSMATVQFLFSLQDEYDITVPVSEFDR
DEWNTVNKIADRVKELQA
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaagattcaagaactcttagcccaagcaactggccgtgacgccgctgacttc
gccgatgccgacgaaaacctctttgactccggtttgatcgactccatggccaccgttcaa
ttcctcttctccttgcaagacgaatacgacatcaccgttccggtgtccgaatttgaccgt
gacgaatggaacacggtcaacaagatcgccgaccgggtcaaggaattacaagcataa

DBGET integrated database retrieval system