KEGG   Lactobacillus fermentum F-6: LBFF_1013Help
Entry
LBFF_1013         CDS       T02669                                 

Definition
(GenBank) Threonine dehydrogenase related Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lff  Lactobacillus fermentum F-6
Pathway
lff00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBFF_1013
Enzymes [BR:lff01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LBFF_1013
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LBFF_1013
    1.1.1.-  
     LBFF_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc Pyr_redox_2 F420_oxidored Pyr_redox 2-Hacid_dh_C 3HCDH_N AstA
Motif
Other DBs
NCBI-ProteinID: AGL88907
Position
1051161..1052213
Genome map
AA seq 350 aa AA seqDB search
MKAAVWHGAKDIRVEDVDLKPTKDNEVVVKVAWTGICGSDLHEYQEGPIFIPVGHKDKLT
GGEAPVTLGHEFCGVIEKVGKDVTKFKVGDHVSVNPTVTHGKVPDNVDVYDGYSFIGLAC
DGGLAPLVNIPEENLYLLPKDFPLRIAATIEPTAVAVQAIKEGGLKFGENVAIFGAGPIG
VLVAAAAKAAGASKIIVSDLSEIRLKKALEMGATDVIKSDQEDAVKKIKELVPGGVDVSF
EVAGVKPTFDQAIEATKARGTMVIVAIYGHPIEFNPMQLTNTGVKITSTIAYSRETFQQT
VDLVTKGSLVVEPVITKEITIDQVVSDGFEALTNDKAQAKILINVDGEDD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtttggcatggtgcaaaagacattcgggttgaagatgttgatctgaaa
ccaactaaggataacgaagtggtggttaaggttgcctggactgggatttgtgggagtgac
ctccacgaataccaagagggaccaatcttcatcccggtcggccacaaggataaattaacc
ggtggtgaagctccggtgaccttgggccacgaattttgcggggtaattgaaaaggttggt
aaagacgttaccaagtttaaagttggcgaccacgttagcgttaacccgactgtcacccac
ggcaaggtgcccgacaacgttgacgtatacgatggctactccttcatcggacttgcttgc
gatggtggtttagcgccgttagttaacatcccggaagaaaacctctacctacttccaaag
gacttcccgttgcggattgcagccaccattgaaccaacggcggtggccgttcaagccatc
aaggaaggtggcctcaagtttggtgaaaacgtggccatcttcggggctggtccaattggg
gtcttggtagcggcggcggccaaggcggccggggcctccaagatcattgtttccgacctg
tcagagattcgtttgaagaaggcccttgaaatgggggcgaccgacgtcatcaagtccgac
caagaagacgccgtaaagaagattaaagagctcgttccgggcggggtcgacgtctccttt
gaagtggctggggtaaagccaacctttgaccaagccatcgaagccactaaggcacggggt
acgatggtaattgtggccatttacggccacccaatcgaatttaacccaatgcagctgacc
aataccggggttaagatcaccagcacaatcgcttactctcgggaaaccttccaacaaacg
gtcgacctggttaccaagggctcgttggttgtggaaccggtcatcaccaaggaaatcacg
atcgaccaagtggtatccgatgggtttgaagccctcaccaatgataaggcccaagcaaag
attttgatcaacgtcgatggcgaagacgactag

DBGET integrated database retrieval system