KEGG   Lactobacillus fermentum F-6: LBFF_1081Help
Entry
LBFF_1081         CDS       T02669                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lff  Lactobacillus fermentum F-6
Pathway
lff00071  Fatty acid degradation
lff00072  Synthesis and degradation of ketone bodies
lff00280  Valine, leucine and isoleucine degradation
lff00310  Lysine degradation
lff00362  Benzoate degradation
lff00620  Pyruvate metabolism
lff00630  Glyoxylate and dicarboxylate metabolism
lff00640  Propanoate metabolism
lff00650  Butanoate metabolism
lff00900  Terpenoid backbone biosynthesis
lff01100  Metabolic pathways
lff01110  Biosynthesis of secondary metabolites
lff01120  Microbial metabolism in diverse environments
lff01130  Biosynthesis of antibiotics
lff01200  Carbon metabolism
lff01212  Fatty acid metabolism
lff02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBFF_1081
   00630 Glyoxylate and dicarboxylate metabolism
    LBFF_1081
   00640 Propanoate metabolism
    LBFF_1081
   00650 Butanoate metabolism
    LBFF_1081
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBFF_1081
   00072 Synthesis and degradation of ketone bodies
    LBFF_1081
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBFF_1081
   00310 Lysine degradation
    LBFF_1081
   00380 Tryptophan metabolism
    LBFF_1081
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBFF_1081
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBFF_1081
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBFF_1081
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lff04147]
    LBFF_1081
Enzymes [BR:lff01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBFF_1081
Exosome [BR:lff04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBFF_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III MelC1
Motif
Other DBs
NCBI-ProteinID: AGL88975
UniProt: R4RI41
Position
1106277..1107449
Genome map
AA seq 390 aa AA seqDB search
MEKVVFVGAARTPIGKLGGALATLTAAQLGTIAIQAALERAAVAPEEVNEVYLGCAIQAG
QGQNVARQASIAAGLPVTVPATTVNVMCGSGMHAVNLAAKLIAMGDAEVMVAGGTESMST
APYLMPKGRFGYKYGNAELVDALYKDGLEDAFFHYPMGCTAENLVEKYQVTREDLDHFAL
QSQVRARTAQDAGRFKDEIVPVTVKGKRHQLEVTEDEAIRDTTMEKLAALKPVFKEGGDV
TAGNSSGLNDGAAALILMSERRALAEGKEILGYWQAGTLAGVKPELMGIGPLAATKKLLA
QVDMTPDQLDLIEINEAFAAQAIVCQRELGFEESKVNVNGGAIALGHPLGDSGARILVTL
LYQMKRQNAKRGLGTLCIGGGMGAATLVYR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgttttcgttggagctgcacggacgccaattggaaagctcggtggcgcc
ctggccacactgaccgctgcccagttgggaacaattgccatccaggccgccttagagcgg
gccgctgttgctcccgaagaagtgaatgaggtctacctgggctgcgccatccaggccggc
caggggcaaaacgtcgcccgccaggccagcattgccgccgggttgccggttaccgttccg
gccaccaccgttaacgtgatgtgtggctccggaatgcacgccgttaacctagcggccaag
ctgattgccatgggggacgccgaagtgatggtggcggggggcaccgaaagcatgtcgacg
gccccgtatttgatgcccaagggccgctttggttacaagtacggtaatgccgaactggtc
gacgccctgtataaggacgggttggaagacgccttcttccactacccaatgggttgcacg
gccgaaaacctggtcgaaaaataccaggtgactagagaagacctcgaccacttcgccctg
caaagccaagtgcgggcacggacggcgcaagacgcggggcgttttaaagacgaaatcgtg
ccggtgaccgtcaagggcaagcgccaccaacttgaagttacagaagacgaggcgattcgc
gacacgacgatggaaaaattagcggccttaaagccggtctttaaagaaggtggcgacgtg
acggccggcaattcttccggattaaatgacggcgccgctgctttaatcctaatgagcgaa
cgccgggctctggcggaaggcaaggaaattctcggctactggcaggccggcaccttggcc
ggggtcaagccggaactgatggggatcggccccttggcggccaccaagaagctgctcgcc
caggttgacatgacgcccgaccagcttgacctgatcgaaattaacgaagcctttgccgcc
caagcgatcgtttgccagcgcgaattgggcttcgaggagagcaaggtgaacgtcaacggt
ggggcaattgcccttggtcatcccctgggcgactccggggcccgcattttggtgacccta
ctctaccaaatgaagcgccaaaacgccaagcgggggctggggaccctgtgcattggcggc
gggatgggcgctgccaccctcgtctaccgttag

DBGET integrated database retrieval system