KEGG   Leptospirillum ferriphilum ML-04: LFML04_0825Help
Entry
LFML04_0825       CDS       T02319                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
lfi00020  Citrate cycle (TCA cycle)
lfi00640  Propanoate metabolism
lfi00660  C5-Branched dibasic acid metabolism
lfi01100  Metabolic pathways
lfi01110  Biosynthesis of secondary metabolites
lfi01120  Microbial metabolism in diverse environments
lfi01130  Biosynthesis of antibiotics
lfi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LFML04_0825 (sucC)
   00640 Propanoate metabolism
    LFML04_0825 (sucC)
   00660 C5-Branched dibasic acid metabolism
    LFML04_0825 (sucC)
Enzymes [BR:lfi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LFML04_0825 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Citrate_bind GARS_A
Motif
Other DBs
NCBI-ProteinID: AFS53058
UniProt: J9ZAV4
Position
767038..768228
Genome map
AA seq 396 aa AA seqDB search
MNIHEYQAKELFKEFGIPVPNGVLVESVEEARKVVNESPLFRGESRPAVWAVKAQIHAGG
RGKAGGVKLARKSEEIPDLVSQILGKTLVTHQTGPEGKKVLKVWIEEGSNIAREFYLGVV
VDRTTRRMTLIASTEGGMEIEEVAEKHPEKIFHLALDPLEGYSPYIGRRVSQFLGLPFST
QTQMVNIVRDLLDFFQRRDASMVEINPLVLTREDRLIALDAKVGFDDNAVGRQPAIRGLR
DLSEENPLEIEASKYNLNYVKLDGNIACMVNGAGLAMATMDVIALAGGSPANFLDVGGGA
SKETVEQAFRIILGDPHVKGIFVNIFGGIVRCERIAGGIIAAAQDVKITIPLVVRLQGTN
AKEGREMLRSSGLAIQVAEELYEGAEKIVLAVKGDK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgaatattcatgagtaccaggcaaaggaacttttcaaggagttcgggattcctgttccg
aatggagttcttgtcgagtcggttgaggaagcccggaaggtcgtcaacgagtctcctctc
ttccgcggggaatccaggcctgccgtgtgggctgtcaaagcccagatccatgccggtgga
agagggaaggcgggtggggtgaagcttgccagaaagtcggaggagattccggatcttgtt
tcccagattctgggaaagacccttgtgactcatcagacgggcccggaagggaagaaagtc
ctcaaggtctggattgaagaagggtcgaacatcgcccgggagttctatcttggagtcgtc
gtcgacaggacgacccgtcgcatgactctcatcgcaagtaccgaaggagggatggagata
gaagaggttgccgagaaacacccggagaaaatcttccatcttgcactggaccctctggag
ggatattccccctatattggaagacgcgtcagtcagtttctggggttgccattttccacg
cagacacagatggtcaacattgtccgtgaccttttggacttctttcagagacgggatgcg
agcatggtggaaatcaatccccttgtgctcaccagggaagatcggctcatcgcactggac
gcaaaagtgggttttgatgacaatgctgtaggaagacaaccggctattcggggactccgg
gatttgtcggaagagaatccgcttgaaattgaagcatcaaaatacaatctgaactatgta
aagcttgatggaaatattgcctgtatggtcaatggtgccggtcttgccatggcgacgatg
gatgtgatcgctcttgccggcggttctcctgcgaactttctcgatgttggagggggcgcc
agcaaggaaacggtcgagcaggcgttccggattatccttggagatccccatgtcaaaggg
atctttgtcaacatttttggtgggatcgtccgctgcgaaagaattgccggcggaattatt
gcggccgcacaggacgtcaagattacgattcctctcgttgtccgtcttcaggggacaaac
gcgaaagagggacgagaaatgctccggagttccggtttggccatccaggtggcggaggaa
ctttacgaaggagcggagaagattgtattggccgtaaagggggacaaatga

DBGET integrated database retrieval system