KEGG   Leptospirillum ferriphilum ML-04: LFML04_1630Help
Entry
LFML04_1630       CDS       T02319                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
lfi00030  Pentose phosphate pathway
lfi00480  Glutathione metabolism
lfi01100  Metabolic pathways
lfi01110  Biosynthesis of secondary metabolites
lfi01120  Microbial metabolism in diverse environments
lfi01130  Biosynthesis of antibiotics
lfi01200  Carbon metabolism
Module
lfi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LFML04_1630
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LFML04_1630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lfi04147]
    LFML04_1630
Enzymes [BR:lfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     LFML04_1630
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     LFML04_1630
Exosome [BR:lfi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LFML04_1630
  Exosomal proteins of colorectal cancer cells
   LFML04_1630
  Exosomal proteins of bladder cancer cells
   LFML04_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AFS53833
UniProt: J9ZDE9
Position
complement(1556713..1558200)
Genome map
AA seq 495 aa AA seqDB search
MDLKVAPPLTLVIFGASGDLTRRKLLPSLYDLWADGLMNADTEIVGVARRVKSHAEFREE
ISEGIRSYSRSGAKNDEKLESFLSRVFYQSGDFEDPSTYDTLRAALLEEGRVKRTRGNVI
FYLATPPSYFVPIIRQIGDHGLAGVPGGGAENLPFTRIVIEKPFGRDLSSARELNGELLT
VFREEQVYRIDHYLGKETVQNILVFRLANPIFGELWSNVHVSRVEIRVMESLGMEGRGGY
FEEAGILRDMIQSHLLQLLSLTAMEPPVAFEAQAIRDEKVKVLRSLKPYSKEEISANILR
GQYVQGVFEGTPVPGYREEAKVSPGSRVETFAALRLEIQNWRWAGVPFFLIAGKRLKKKS
TEITLFFKAHPFAIFRLAQCDDNIPNSLTIRIQPNEGVSIRFGLKRPSSGLHIDPAEMDF
SYQEVYQDHPPDAYERLLHDAMVGDSTLFARNDEVERAWAYITPFLSDPQTARVPVFYEA
GSDGPEELSTFLSRS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggatctgaaggttgcccctccactcacacttgtcatttttggtgcttcaggagatttg
acccgtcggaaactcctgccttccctctatgatctgtgggcggacgggttgatgaatgct
gacaccgaaattgtcggtgttgcacgccgtgtcaaaagtcatgcagaattccgggaggaa
atttccgagggaattcgttcttattcacgctccggagccaaaaacgacgaaaagcttgag
tcttttctgtctcgcgttttttatcagtccggtgattttgaggatccgtccacatacgac
acgttgcgggcagccttgctggaagaagggagagtcaagcggacacgcgggaatgtcatt
ttttatctggccactcccccgagctattttgttccgattatccgccagatcggagaccac
ggtctggcgggtgtgccgggaggaggcgccgaaaaccttccctttacccggatcgtgatc
gaaaagcctttcggtcgggatttgtccagtgcgagagagttgaacggggaacttctgacg
gtctttcgggaggagcaggtctatcgaatcgatcattacctggggaaagaaacggttcag
aatattctggttttccgcctggccaatccgatctttggtgaactctggagcaatgtccat
gtttcccgcgtcgaaatccgggtgatggaaagtctggggatggaagggcgtggcggttac
tttgaagaagccggaattctgcgggacatgatccagagccatttactgcagctgctctcc
ctgacggcgatggaaccgccggttgccttcgaagcccaggcgatccgggatgagaaagtc
aaggttctccgttctctgaagccctattcaaaagaggaaatttcggcaaacattttaagg
gggcaatatgtccagggcgtcttcgaaggcacccctgtcccgggataccgggaggaggcc
aaggtgtccccgggatcccgtgtcgaaacgtttgccgctcttcgactcgaaattcagaac
tggcggtgggctggcgttccgttttttctgattgccggaaagaggctcaagaaaaagtct
accgagatcactcttttcttcaaggcgcaccccttcgcgatttttcggcttgcccaatgc
gacgataatattccgaattcactcacgatccggattcagccgaatgaaggtgtgtccatt
cgcttcggtctcaagagaccgtcgtccgggctgcatatcgatccggccgagatggacttt
tcctaccaggaagtctatcaggaccatccgccggacgcctatgaaagactgttgcatgat
gccatggtcggggactccaccctctttgcccgaaacgacgaggtggagagggcctgggcg
tatatcacgccattcctctccgatcctcagacggcgcgtgttcctgtcttttatgaagcg
ggctcggacgggccggaagaactgtccacctttttgagcaggtcctga

DBGET integrated database retrieval system