KEGG   Leptospirillum ferriphilum ML-04: LFML04_1634Help
Entry
LFML04_1634       CDS       T02319                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
lfi00010  Glycolysis / Gluconeogenesis
lfi00052  Galactose metabolism
lfi00500  Starch and sucrose metabolism
lfi00520  Amino sugar and nucleotide sugar metabolism
lfi00521  Streptomycin biosynthesis
lfi01100  Metabolic pathways
lfi01110  Biosynthesis of secondary metabolites
lfi01120  Microbial metabolism in diverse environments
lfi01130  Biosynthesis of antibiotics
lfi01200  Carbon metabolism
Module
lfi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFML04_1634 (glk)
   00052 Galactose metabolism
    LFML04_1634 (glk)
   00500 Starch and sucrose metabolism
    LFML04_1634 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LFML04_1634 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LFML04_1634 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LFML04_1634 (glk)
Enzymes [BR:lfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LFML04_1634 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFS53837
UniProt: J9ZDY1
Position
complement(1564327..1565361)
Genome map
AA seq 344 aa AA seqDB search
MRDGWIVAGDIGGTKTALGLFSPEDLQKSIRSRNLPEARVSERYPSQEFSGLIPIVETFL
EKNRSILNGYPIWATFGVAGPVLENRCQTTNLPWVIEGEGLEKNFGWKQGTVHLVNDLVA
MGWGINVVRSSGGIHWLRAGNADKRGNAVLVAPGTGLGEALLEEDHGSLRPWPSEGGHTD
WAPFNPEQVRLLQFLWTQFDHVSSERLLSGPGLLNIYRFVSQGSPAPTLLDRGIPEEHLP
EHITQAALDGTDPCSPPTLRLFVEILAQEAGNMALKALATGGVFLGGGIPVKILSFLKES
SFLERMSQKGRYRELLDTVPVGVLLQEETPLWGAAYEAMLRMPV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatggctggattgtggccggcgatatcggcgggacgaagacagcactggggctc
ttctccccagaggaccttcagaaatcgatacgctccagaaatctcccggaagcgcgtgtt
tctgaacgctatccgagtcaggagttttcgggcctgattccgatcgtcgagacctttctt
gaaaaaaatcgttccatcctgaacggatatccgatctgggcgacctttggtgttgcgggg
ccggttctggaaaaccgttgtcaaacgaccaatcttccctgggtcattgaaggagagggt
ctcgaaaaaaattttggatggaaacaggggacggttcatttagtcaacgatctggtggcc
atgggatgggggatcaatgtcgtccggagttccgggggaatccactggcttcgggcggga
aatgccgacaaaagaggcaatgcggtcctggtggcaccggggaccggtttgggagaagct
ctgctggaagaggatcatggaagcctgcgtccctggccgtccgaaggagggcacaccgac
tgggctcccttcaaccccgagcaagtgaggcttctccagtttttgtggacgcaatttgat
cacgtgagctctgaacgcctcttgtccggtcccggacttctcaatatctaccgcttcgtc
tctcagggatctccggctccgacacttctcgacaggggaattcccgaagaacaccttccc
gaacatattacccaggcggctctggatgggaccgatccctgttccccgcccacgctcaga
ttatttgtcgagattcttgcccaggaagcggggaacatggctctcaaggctcttgcgacc
ggaggggtgtttctggggggaggaattccggtcaagatcctgtcctttttgaaagaatcg
tcttttctggagcgcatgtcccagaaagggcgctaccgtgaactcctcgatacggttccg
gtgggagtgcttcttcaggaagagacccctctgtggggggcggcgtatgaggcgatgctg
agaatgccagtctaa

DBGET integrated database retrieval system