KEGG   Lactobacillus farciminis: LF20184_10575Help
Entry
LF20184_10575     CDS       T06098                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lfm  Lactobacillus farciminis
Pathway
lfm00450  Selenocompound metabolism
lfm00970  Aminoacyl-tRNA biosynthesis
lfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LF20184_10575
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LF20184_10575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lfm01007]
    LF20184_10575
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lfm03016]
    LF20184_10575
Enzymes [BR:lfm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LF20184_10575
Amino acid related enzymes [BR:lfm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LF20184_10575
Transfer RNA biogenesis [BR:lfm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LF20184_10575
 Prokaryotic type
   Other AARSs
    LF20184_10575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART MAP65_ASE1
Motif
Other DBs
NCBI-ProteinID: ATO47159
Position
complement(2159259..2161277)
Genome map
AA seq 672 aa AA seqDB search
MTEERKTFYITTPIYYPSGKLTIGNSYTTIAADTLARYKRNEGYDVFFLTGTDEHGLKIE
QKAEEKHMQPQEYVDMMAKGIKELWKKLDISNDKFIRTTDDYHVKAVQKIIERLIKQGDI
YLGEYAGWYSVDDEEYFTESQLAEVYRDKDGKVTGGKAPSGHEVQLVKEPCYFFRMNKYA
DRLLQYYKDNPTFIQPEIRKNEMINNFIKPGLEDLAISRTSFNWGVKIPSNPEHVVYVWV
DALLNYITALGYGSDDDSLFKRYWPANVQFVGKEIVRFHTIYWPIILMALDLPLPKQVFG
HGWLLMKDGKMSKSKGNVVYPEMLVSRYGLDSLRYYLMRAMPFGNDGVFTPEDYIDKINY
DLANDLGNLLNRTISMINKYDDGKIVTTTAVTDLDKDLEKTYADTLAQYRDHMNKFEFPE
ALASVWAFISRANKYIDETQPWVLAKDDAKKAELQSVLGHLAESLRLIALLISPVMTQAP
VKMFAQLGLDYDKDKSLEFGETVVGKTVTAKPEPIFPRLDAKEEVEYIKGKMAEEQAKHG
AGKLSKSAQAKAKAQKEADDGFPKEIEFDDFAKVKMVVTEILDVKPVENSSKLLQFKLDD
GSGVDRQILSGMHKFYPNYKELIGKKVLAVVNLKPRKMVGEWSNGMLLSTEKGDEVKLAI
VDNSHKNGAILG
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaagaaagaaaaactttttacattacaacacccatttattatccatctggaaaa
ttaacaattgggaattcatatacgacgattgcagcggacactctagcccgttacaagcgt
aatgaaggctatgatgtgttcttcttaacaggaactgacgaacatggtctaaaaatcgaa
caaaaggccgaagaaaagcacatgcaaccacaagaatacgtggacatgatggctaaaggc
attaaagaactttggaagaaactagatatttccaatgacaaatttatccgtacaactgat
gattatcacgttaaagcggttcaaaagattattgaacgtctgatcaaacaaggcgatatt
tacttaggcgaatatgctggctggtattcagttgacgatgaagaatatttcactgaatca
caattggctgaagtttaccgcgataaagatggtaaagtcacaggtggtaaagctccttca
ggacatgaagttcaattagtcaaagaaccttgttatttcttcagaatgaacaagtatgct
gaccgcttattgcaatactacaaagacaatccaaccttcatccaaccagaaattagaaaa
aatgaaatgatcaacaactttatcaaaccaggtcttgaagacttggctatttcacgtact
agtttcaactggggcgttaagattccaagtaaccctgaacacgttgtttacgtttgggtc
gatgctttgttgaactatattacagctctaggttacggtagcgacgatgattctctattc
aagagatactggcctgctaatgtccaattcgttggtaaagaaatcgttcgtttccataca
atttactggccaattattttgatggcactagatttgccacttcctaagcaagtcttcggt
catggttggctattgatgaaagacggtaagatgtctaagtctaaaggtaacgttgtttac
ccagaaatgttagtttcaagatacggactagattcattacgttattacttgatgcgtgct
atgccatttggtaatgatggtgtcttcactcctgaagattatattgacaagatcaactac
gatttggctaatgaccttggtaacttgttgaatagaactatttctatgatcaataagtac
gacgacggtaaaatcgttacaactacagctgtgactgatttggataaagatttagagaag
acttatgctgacactttggcacaatatcgtgatcacatgaataagtttgaattcccagaa
gctctagctagcgtttgggcctttatcagtcgtgctaacaagtatatcgatgaaacacaa
ccttgggttcttgctaaagatgatgctaagaaggctgaattacaatcagttcttggacat
ttagctgaatcattacgcttgattgctcttctaatcagtcctgttatgacacaagcccct
gtaaagatgtttgctcaattaggattggattacgataaagataagtcacttgaatttggt
gaaactgtcgttggtaagactgttactgccaaaccagaaccaatcttcccaagacttgat
gctaaagaagaagttgaatacatcaaaggcaaaatggctgaagaacaagctaagcatggt
gctggtaagttgagtaagtctgctcaagctaaggctaaggcgcaaaaagaagctgacgat
ggtttccctaaggaaattgaattcgacgactttgccaaagttaagatggtcgtaactgaa
attcttgatgttaagccagttgaaaactcaagtaaattactacaattcaaactagatgat
ggttctggcgttgatcgtcaaatcctttcaggtatgcacaaattctatcctaactacaaa
gaattgattggtaagaaggttctagcagttgttaacctcaaacctcgtaagatggttggc
gaatggagtaacggaatgttgctttcaactgaaaagggcgacgaagttaaactagctatc
gtggataattcacacaaaaatggagctattttaggttaa

DBGET integrated database retrieval system