KEGG   Leptospirillum ferriphilum YSK: Y981_10990Help
Entry
Y981_10990        CDS       T03197                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lfp  Leptospirillum ferriphilum YSK
Pathway
lfp00670  One carbon pool by folate
lfp01100  Metabolic pathways
lfp01120  Microbial metabolism in diverse environments
lfp01200  Carbon metabolism
Module
lfp_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lfp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Y981_10990
Enzymes [BR:lfp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Y981_10990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AIA31076
UniProt: A0A059Y0L3
Position
complement(1969320..1970993)
Genome map
AA seq 557 aa AA seqDB search
MRLDKMAQSMGVPETHFHPFGPGRAKIDPRYLETFSPPSFGREPSPLYVLVTGMTPTPLG
EGKTTTSIGLSMALNRLGTRTVVTIRQPSMGPVFGIKGGGAGGGKSTIEPSDVLNLHLTG
DVHAVGAAHNLLASAIDNEIHHGNRLEINPLTVGWPRVVDLNDRALRKVIVGLGGAANGS
PRETRFDITVSSEVMAILALSTSYGDLIDRLGDIGFGLSRDGRLLKARDLEVEGAMAAVL
REGFWPNLMSTSEGTPAIVHGSPFANIAHGNSSIIGDWVGLSGSDCVVTEAGFGADLGGE
KFFDIKCRALGRGPDVAVLVATAKSLRMHGGLADTVAGRPIPEILDKSDVPSVRQGMQNL
LRQISNVRRFHVPVVVAINAHPGDSPEEWNVIRDLSMEGGAEDAIVCTHFRDGGAGALEL
AERVREVCRLKKASYRPLYPDDLPVEEKIRTVAREMYGARDVTFSPKAKKSLADIERYGA
AGFPVCIAKTWASLSHDPSQKGAPSDFLFPVEEIRYATGARFVTAIAGDIQTMPGLPSRP
AYRRIRLTSGGNVEGVS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttgataagatggcccagtcgatgggtgttccagaaactcattttcatcctttt
ggtccggggcgggcaaagattgatccccggtatcttgaaacgttctctccgccctctttc
ggccgggaaccttctccgctctatgttctggtgaccggaatgacgccgacgccccttggt
gaaggaaaaaccaccacctcgatcggattgtccatggcgttgaaccgtctgggaacccgc
acggtcgtgacgattcgccagccgtcgatgggaccggtgttcgggatcaagggaggcgga
gcggggggaggaaaatccaccatcgaaccgtcggatgtcctgaacctccatctgacggga
gacgttcatgcggtcggcgcggcacacaatcttctggcgtcggccattgacaacgagatt
caccacggaaaccgtctggaaatcaaccctctgaccgtcggatggccacgggtggtcgat
ctgaacgatcgcgcgcttcgcaaggtgatcgtcggtctgggaggggctgccaacggatcc
ccccgggaaacccgtttcgatatcactgtttcatcggaagtgatggccatcctggctctc
tccacgtcgtacggggatctgatcgaccgtctgggcgatatcggatttggtctttcccgc
gacggacgtctgctgaaggcccgggatctggaagtcgaaggggcaatggccgcggttttg
cgggaagggttctggccgaacctgatgtcgacgtccgaagggacgccggcgatcgtgcat
ggttccccttttgccaatatcgctcacgggaacagttccattatcggagactgggtcggg
ttgtccggttccgactgtgttgtgacagaagcgggttttggtgcagacctcgggggcgaa
aaattcttcgacatcaaatgccgggctctcgggagaggaccggatgtggcggtccttgtg
gccacggccaaaagtctgcgcatgcatggcggtctggcggacacggttgcgggacgtccg
attcctgaaattctggacaaaagtgacgtgccttcggtgcgtcaggggatgcaaaacctg
ttgcggcaaatttccaatgtccggcgctttcacgttcctgtcgtggtggcgataaacgcc
catcccggtgactcaccggaagaatggaacgttattcgtgatctttccatggaaggcgga
gccgaagatgcaattgtctgtacacatttccgggatggaggagccggtgccctggagctt
gcggagagggtccgggaggtttgtcgtttgaagaaggcttcctacaggccactctatccg
gatgatcttccggttgaggagaagatccggaccgtggctcgcgaaatgtacggagccaga
gacgtcacgttttctccaaaagccaaaaaatcccttgcggatatcgagcgctatggagct
gccggctttcccgtgtgtatcgccaaaacctgggcttccttgtcacatgacccgtctcaa
aaaggagccccttcggactttctttttcctgtggaggaaatccgttatgccacaggagcc
cgatttgtgacggcaatcgcgggtgatatccagacaatgccgggtcttccctcaaggcct
gcataccgacgaatccggctgacctccggcggaaacgtggagggagtttcttga

DBGET integrated database retrieval system