KEGG   Lactobacillus fermentum CECT 5716: LC40_0139Help
Entry
LC40_0139         CDS       T01958                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
lfr00900  Terpenoid backbone biosynthesis
lfr01100  Metabolic pathways
lfr01110  Biosynthesis of secondary metabolites
lfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LC40_0139
Enzymes [BR:lfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LC40_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADJ40800
UniProt: D8IGL9
Position
235669..236520
Genome map
AA seq 283 aa AA seqDB search
MIVTEKAPAKINLALDTPMRYLDGLPRWNMVMNAVDLADYVTVEIHHRPQTIKVYTNSGF
LPNDQRNLAYQAAHILKTRFHQTDGVTIRIKKKIPVAAGLGGGSSDAAAVLRALNKAWRL
GLSLDELARLSLSIDSDVPFCVYSQTAHVTGHGEIVEPLPAFPHYWVVIAKPKLSVSTPV
ILRQINYERLVHPQTDQLVEAIKEGKFQESFQYMGNALEAVTMEAHPEIARLKERMQKLG
ADVAQMSGTGPSVFALCHAESRAKRIYNSLRGFCPEVYQVVLL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgacggaaaaggcaccggccaagattaacttggccctcgatacgcccatgcgc
taccttgacggcctgccccgctggaacatggtgatgaacgccgttgacctggctgattac
gtcaccgtggagattcaccaccgaccacagacgatcaaggtttacaccaacagcggtttt
ttacccaatgaccaacgcaacctagcctaccaagccgcccacatcctaaagacccgcttt
caccagactgatggggttaccatccgaatcaaaaagaagattccggtggcggccggcctc
ggtggcgggtcttcggacgcggcggccgtcttgcgggccctcaataaggcctggcgcctt
ggtttatcgttagacgagttggcgcgcttatccttatcaatcgattccgacgtgccattt
tgcgtgtactcccaaacggcccacgtgaccggccacggggagatcgtggaacccctgccg
gcctttccccactactgggtggtgattgccaaacccaagctatcagtctcgaccccggtt
atcttacgccagattaattacgagcgtttggtccacccgcaaacggaccagctggtggaa
gccatcaaggaaggaaagtttcaggagagctttcagtacatgggtaacgccctagaggcg
gtgaccatggaggcccaccccgaaatcgcccgtttaaaggaacggatgcaaaaattaggg
gccgacgtggcacagatgagcgggactggtcccagtgtctttgccttgtgccacgccgaa
tcacgggccaagcgcatttataacagcctgcgtggcttttgcccggaggtctaccaagtc
gtcttgttataa

DBGET integrated database retrieval system