KEGG   Lactobacillus fermentum CECT 5716: LC40_0201Help
Entry
LC40_0201         CDS       T01958                                 

Definition
(GenBank) Alcohol acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
lfr00010  Glycolysis / Gluconeogenesis
lfr00071  Fatty acid degradation
lfr00350  Tyrosine metabolism
lfr00620  Pyruvate metabolism
lfr00625  Chloroalkane and chloroalkene degradation
lfr00626  Naphthalene degradation
lfr00650  Butanoate metabolism
lfr01100  Metabolic pathways
lfr01110  Biosynthesis of secondary metabolites
lfr01120  Microbial metabolism in diverse environments
lfr01130  Biosynthesis of antibiotics
lfr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC40_0201
   00620 Pyruvate metabolism
    LC40_0201
   00650 Butanoate metabolism
    LC40_0201
  Lipid metabolism
   00071 Fatty acid degradation
    LC40_0201
  Amino acid metabolism
   00350 Tyrosine metabolism
    LC40_0201
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LC40_0201
   00626 Naphthalene degradation
    LC40_0201
Enzymes [BR:lfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LC40_0201
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LC40_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 E2F_CC-MB
Motif
Other DBs
NCBI-ProteinID: ADJ40851
UniProt: D8IGS0
Position
344861..347464
Genome map
AA seq 867 aa AA seqDB search
MAKQSEPQKMTKTEKMVDDLVQKAHQALDIMSEFDQKKVDYITHQMVEAGQDKHMELAIE
AVKETGRGIVEDKAIKNMFATEEIWHNIRKDHTVGVIEDNKADELITVAEPLGVLAGITP
VTNPTSTTLFKAIIAMKTRNPIIFSFHPQALECSRHAARIVRDAAIAAGAPEGAIQWIDE
PSRESSTALINNPGIACTLATGGPGMVRAAYSTGKPALGVGPGNGPVYIEKTAKIARAVN
DIVLSKTFDNGMICATENSAVIDHEIYDEVKADLKANRVYFVPQNEHAKLRKVMFNEQTG
GVNGPIAGKSAMQIAEMADIKVPEDTQVLAVEVNAIGKQELLSGEKLSPVLSVYKAMDQQ
DAFDKCEALLNYGGLGHTAAIQTQNMDLAREFGVAMKASRIIVNSPSGLGGIGNIYNRMT
PSLTLGTGSWGENSISHNVTDYDLLNVKTIAKRRNNMQWIKLPRIYFERDSVRYLKDMPG
IKRVFIVTGPSIQAHGYVDVVTDQLRLRENDVQYLVFSDVEADPSTTTVEKGVALMKSFK
PDTIIALGGGSPLDAAKGMWMFYEDENASFFGAKQKFLNIRKRAYRFDKPKKAQMVAIPT
TSGTGSEVTPFAVITDAKTHVKYPLADYALTPDVAIVDPQFVDTVPKGNIAASGLDVLCH
SIESYVSSMASDYTRPLSLQAIKLVFDNLTASYNGDEEARAAMHNASTLAGMAFGNAFLG
INHSIAHKLGGEFGLTHGIAIAITMPHVIKFNATLPKKFSTWPKYEAFRAADDYATIART
IGLTGDSNEELINKLCDKIKDLAHSLGVTLSLKAWGVDKAHFDKVVDHLAVLAYEDQCTT
ANPQEPLIADLKQIMIDEYDGKGVETK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaagtgaaccacaaaagatgacgaagaccgaaaagatggtggacgacctg
gtccaaaaggcccaccaagcgctcgatatcatgagcgaattcgaccaaaagaaggtggac
tacattacccaccaaatggtcgaggctggccaagataagcacatggaactggcgatcgaa
gccgtcaaggaaaccggtcgtgggatcgtggaagataaggcgatcaagaatatgtttgcg
actgaagaaatttggcacaacattcgcaaggaccacaccgttggggtaattgaagacaac
aaggccgatgagttaattacggttgccgaaccgctcggggtcttagccggaatcacgccg
gttaccaacccaacctcaacgacgctgtttaaggccatcattgccatgaagacccgcaac
ccaatcatcttctccttccacccacaagccttggaatgctcccgtcacgccgctcgaatc
gtgcgggatgccgccatcgccgccggggcaccggaaggagcgatccaatggattgacgaa
ccaagtcgggaatcttcaaccgcattgatcaacaaccctggaattgcctgtaccttagct
actgggggccccggcatggtgagggctgcttactccaccgggaagccagccctgggggtg
ggacctggtaacggtccggtttatatcgaaaaaaccgctaagattgcccgggccgtcaac
gacattgttttatccaagacttttgataacgggatgatctgtgccacggaaaactctgcc
gttattgaccacgaaatttacgatgaagtgaaggccgacttgaaggcgaaccgcgtctac
ttcgttccccaaaatgaacacgctaagttgcgcaaggtaatgtttaacgaacaaaccggt
ggggttaacggcccgatcgccggtaagtccgctatgcaaattgccgaaatggccgacatt
aaggtgccagaagacacccaggtcctggccgtcgaagttaatgccattggtaagcaagaa
ctactctccggtgaaaagctgagcccagttttgtcggtttacaaggccatggatcaacaa
gatgcctttgataagtgtgaagccctacttaactacgggggactgggccacacggctgcc
attcaaacccaaaacatggacctagctcgtgaatttggggtggcgatgaaggcctcacgg
atcatcgttaactccccgtccggactcggtgggattgggaacatctacaaccggatgacc
ccatctttgaccctagggactggttcatggggggagaactcgatttcccacaacgtgacc
gattacgatttgctaaacgtaaagacaattgccaagaggcggaataacatgcaatggatt
aaattaccacggatctacttcgaacgcgattctgttcgttacctcaaggatatgccaggg
atcaagcgggtcttcatcgttactggcccatcaattcaagcccacggctacgttgatgtg
gtgaccgaccaattgaggctgcgggaaaacgatgtccaatacctggtcttctccgatgtc
gaagccgatccatccacgacgacggttgaaaaaggggttgccctgatgaagagcttcaag
ccggacacgattatcgctttgggtgggggttcgccgctggacgccgccaaggggatgtgg
atgttctacgaggacgaaaatgcttccttcttcggggcaaagcaaaagttcttgaacatc
cgtaagcgggcctaccgcttcgacaagccgaagaaggcccaaatggtggcgatcccaacc
acttccgggaccgggtccgaagtaacgccgttcgctgtgattacggacgccaagacccac
gtgaagtacccactggccgattacgctttgacgccggacgtggccatcgttgacccccag
tttgtggacacggtaccaaagggcaacatcgccgcttccggtttggacgtcttgtgccac
tcgattgaatcctacgtttccagcatggcctccgattacacccggccgctgtccttgcaa
gccatcaagttagtctttgacaacttaaccgcttcgtacaatggggatgaagaagcccgg
gctgccatgcacaacgcttcgaccttagccgggatggcctttgggaacgccttcttaggg
atcaaccactcaatcgcccacaagctgggtggtgagtttggcctgacccacgggatcgcc
atcgccatcacgatgccacacgtcatcaagtttaacgccaccctgccaaagaagtttagc
acgtggccgaagtacgaagccttccgggccgccgatgactacgcaacgatcgcccgcacg
atcggtttgaccggcgactccaacgaagagttgatcaacaagctctgcgacaagatcaag
gacttggcccactcgctgggtgtaaccctgagcttgaaggcctggggcgtcgacaaggct
cacttcgacaaggtggttgaccacctagccgtcttagcctacgaagatcaatgtacgacg
gctaacccgcaagaaccactgattgccgacctgaagcaaatcatgatcgacgaatacgac
gggaagggcgtcgaaaccaagtaa

DBGET integrated database retrieval system