KEGG   Lactobacillus fermentum CECT 5716: LC40_0618Help
Entry
LC40_0618         CDS       T01958                                 

Definition
(GenBank) Possible (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
lfr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LC40_0618
Enzymes [BR:lfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LC40_0618
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LC40_0618
    1.1.1.-  
     LC40_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc Pyr_redox_2 F420_oxidored UDPG_MGDP_dh_N Pyr_redox 2-Hacid_dh_C 3HCDH_N AstA
Motif
Other DBs
NCBI-ProteinID: ADJ41229
Position
1099343..1100395
Genome map
AA seq 350 aa AA seqDB search
MKAAVWHGAKDIRVEDVDLKPTKDNEVVVKVAWTGICGSDLHEYQEGPIFIPVGHKDKLT
GGEAPVTLGHEFCGVIEKVGKDVTKFKVGDHVSVNPTVTHGKVPDNVDVYDGYSFIGLAC
DGGLAPLVNIPEENLYLLPKDFPLRIAATIEPTAVAVQAIKEGGLKFGENVAIFGAGPIG
VLVAAAAKAAGASKIIVSDLSEVRLKKALEMGATDVIKSDQEDAVKKIKELVPGGVDVSF
EVAGVKPTFDQAIEATKARGTMVIVAIYGHPIEFNPMQLTNTGVKITSTIAYSRETFQQT
VDLVTKGSLVVEPVITKEITIDQVVSDGFEALTNDKAQAKILINVDGEDD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtttggcatggtgcaaaagacattcgggttgaagatgttgatctgaaa
ccaactaaggataacgaagtggtggttaaggttgcctggactgggatttgtgggagtgac
ctccacgaataccaagagggaccaatcttcatcccggtcggccacaaggataaattaacc
ggtggtgaagctccggtgaccttgggccacgaattttgcggggtaattgaaaaggttggt
aaagacgttaccaagtttaaggttggcgaccacgttagcgttaacccgactgtcacccac
ggcaaggtgcccgacaacgttgacgtatacgatggctactccttcatcggacttgcttgc
gatggtggtttagcgccgttagttaacatcccggaagaaaacctctacctacttccaaag
gacttcccgttgcggattgcagccaccattgaaccaacggcggtggccgttcaagccatc
aaggaaggtggcctcaagtttggtgaaaacgtggccatcttcggggctggtccaattggg
gtcttggtagcggcggcggccaaggcggccggggcctccaagatcattgtttccgacctg
tcagaggttcgtttgaagaaggcccttgaaatgggggcgaccgacgtcatcaagtccgac
caagaagacgccgtaaagaagattaaagagctcgttccgggcggggtcgacgtctccttt
gaagtggctggggtaaagccaacctttgaccaagccatcgaagccactaaggcacggggt
acgatggtaattgtggccatttacggccacccaatcgaatttaacccaatgcagctgacc
aataccggggttaagatcaccagcacaatcgcttactcccgggaaaccttccaacaaacg
gtcgacctggttaccaagggctcgttggttgtggaaccggtcatcaccaaggaaatcacg
atcgaccaagtggtatccgatgggtttgaagccctcaccaatgataaggcccaagcaaag
attttgatcaacgtcgatggcgaagacgactag

DBGET integrated database retrieval system