KEGG   Lactobacillus fermentum CECT 5716: LC40_0744Help
Entry
LC40_0744         CDS       T01958                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
lfr00260  Glycine, serine and threonine metabolism
lfr00750  Vitamin B6 metabolism
lfr01100  Metabolic pathways
lfr01110  Biosynthesis of secondary metabolites
lfr01120  Microbial metabolism in diverse environments
lfr01230  Biosynthesis of amino acids
Module
lfr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC40_0744
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LC40_0744
Enzymes [BR:lfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LC40_0744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADJ41351
UniProt: D8II72
Position
complement(1319263..1320807)
Genome map
AA seq 514 aa AA seqDB search
MRSFFYYGREITCNTEAPATKRXKQMTAPEAILQGLAPDGGLFVPQSFPQPDYDLGALVN
APYQEVATTIWGWFFDDFSLASRQAIVRGAYGEQWDDSQIAPLSERVAGNYYLELFHGPT
LAFKDVALQALPRLMKEAVTVTGDDKQIIILTATSGDTGSAAMRGFSDVTGTQVVVFYPD
GGVSPVQLRQMLAMKGDNLAAVAVAGNFDDAQTEVKKIFNDQEFAARLAQAGDRFSSANS
MNIGRLIPQLTYYFTAYGQLVKRGEVELGAPVNFAVPTGNFGDILAGYYAKKLGLPIKKL
LCASNQNRVLTDFFATGHYDRRRPFHLTTAPAMDILVSSNLERLLFDLYDQEAGAVASLM
KELNQTGEYQVTDEVLKRLHQDFVADWASEEEISEEIRRIYLAADYVIDPHTAVGSVVAH
RYKERTGDNTPMVVVATASPYKFAETVYPAVTGKETAARGLQAIQGLNEFLGEELSPGVK
ALFEGDQRSEQRVEPSEMAQLIEKRLGLTSEQKE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagatcatttttttattacgggagggagatcacatgcaataccgaagcacccgcgacc
aagcggcycaagcaaatgacggcgcccgaggcgattttacaggggttagccccggacggg
ggcctctttgtgccccagtcgtttccccaaccagactacgacctgggggccctcgttaac
gccccctatcaagaggtcgccaccaccatttggggctggttttttgacgacttttcgctg
gcgagccgtcaagcaattgtccggggggcctatggtgagcagtgggatgattcccagatt
gcacccctaagcgagcgggtggcggggaattattacttagaactcttccacggcccaacg
ctggcttttaaggacgttgccttacaagcccttccccggttgatgaaggaggcggtcacg
gtgaccggtgatgataaacaaatcatcattttgacggccacttccggtgacactggctcg
gcggcgatgcggggctttagtgacgttaccgggacccaagtagttgttttttacccggac
ggtggggtgagcccagtccaactgcgtcaaatgctagcgatgaagggggataacctggcg
gccgtagcggtggccggcaatttcgatgacgcccaaaccgaggttaaaaagatctttaac
gaccaagaatttgccgctcggttagcccaggcgggcgaccgcttttcgtcggcgaactcg
atgaacattggccggctgattccccagcttacttattacttcaccgcttatggccagttg
gtcaagcgcggggaagttgaactcggcgccccggttaactttgccgtgccaaccgggaac
tttggggatatcctcgccggttactacgctaaaaaattaggtctgccgatcaaaaagctc
ctgtgcgcctccaaccaaaaccgggtcctgaccgacttttttgcgaccggccactatgac
cggcgccgccccttccacctcaccacggccccggcaatggacatcctagtttccagtaac
ttagagcgcctcttgtttgatctgtatgaccaagaggcaggggcggtggcttccttaatg
aaggaattgaaccaaacgggcgaatatcaagttaccgacgaagttttaaagcgtctgcac
caagattttgtcgctgattgggccagtgaagaagaaattagcgaagagattcgacggatc
tatttggcagctgactacgtcattgacccccacacggccgtgggttcggtggtggcgcac
cgatataaagaacggacgggggataacaccccgatggtggtggtcgccaccgctagcccc
tacaagtttgccgaaacggtctacccggcggtaacgggaaaggaaacggcggcgcgcggg
ctgcaagcaattcaagggctcaacgaattcttaggtgaggagttaagcccgggggtcaag
gccctgtttgaaggggaccaacgctcagaacagcgggtggaaccaagtgagatggcccaa
ctaattgaaaaacggctcggcttaacgagtgagcaaaaggaataa

DBGET integrated database retrieval system