KEGG   Lysinibacillus fusiformis: HR49_02305Help
Entry
HR49_02305        CDS       T03655                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lfu  Lysinibacillus fusiformis
Brite
KEGG Orthology (KO) [BR:lfu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HR49_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJK86126
UniProt: A0A1E4R0T6
Position
complement(460411..461427)
Genome map
AA seq 338 aa AA seqDB search
MNTIIILTVLVVIFALTFDFINGFHDTANAIATSVSTRALPPRVAIIMAATMNFIGAITF
VGVAKALTKDIVDPFSLNAFEGDTTGSVVILAALISAIIWNLLTWYFGIPSSSSHTLIGS
IAGAAVASAGFDVLNYGGFTKILMALVFSPILAICAGFIMMTLFKLWFKNLNLYRTNKGF
RTMQIFTAAIQSFTHGTNDAQKAMGIMTMALIAGGLHSGDEIPFWVRAAAATAMGLGTSI
GGYKIIKTVGGKIMKIRPVNGVAADLASATVIFGATLIHLPVSTTHVISSSIMGVGSAQR
VRGVNWGMARKIVTTWVITMPISAVMASVIYFVLSLFF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaatcattatactaaccgtactggtcgtcatctttgccctaacatttgacttt
atcaacggcttccatgatactgcaaatgctattgcaacttcggtttccactcgagcattg
ccacctcgtgtagcgatcatcatggccgcaaccatgaactttatcggcgctatcactttt
gtaggggttgctaaagctttaacaaaagacattgtagatccattttctttaaatgccttt
gaaggagacacaaccggctcagtcgttattttggccgcactaatttcagctattatttgg
aatttacttacatggtatttcggtattccatcaagttcttcccacacattgattggctct
atcgcaggtgctgctgtcgcatctgctggcttcgatgtattaaactatggcggctttact
aaaatccttatggcgttagtgttttctccaatactggctatttgtgctggttttattatg
atgacactatttaaattatggtttaaaaaccttaacttatatcgcactaataaaggtttc
cgtacgatgcaaattttcaccgcagccattcaatcgttcacacatggtacgaacgatgcg
caaaaagcaatggggattatgacaatggctttaatcgctggaggattgcatagcggtgat
gaaatacctttctgggtacgtgctgctgctgccacagctatgggtctaggtacatctatt
ggtggttataaaattattaaaaccgttggcggtaagattatgaaaattcgtcctgttaat
ggggtagcggcagacttagcgtcagcaacagttatttttggtgcgacattaatccatcta
cctgtatctacaacacatgttatttcttcatcgattatgggtgttggttctgcacagcgt
gtacgtggcgttaactggggaatggcccgcaagattgttactacttgggttattacaatg
cctatttcagctgtaatggcatccgttatttatttcgtcctatcattattcttttaa

DBGET integrated database retrieval system