KEGG   Lysinibacillus fusiformis: HR49_05890Help
Entry
HR49_05890        CDS       T03655                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
lfu  Lysinibacillus fusiformis
Pathway
lfu00010  Glycolysis / Gluconeogenesis
lfu00020  Citrate cycle (TCA cycle)
lfu00620  Pyruvate metabolism
lfu01100  Metabolic pathways
lfu01110  Biosynthesis of secondary metabolites
lfu01120  Microbial metabolism in diverse environments
lfu01130  Biosynthesis of antibiotics
lfu01200  Carbon metabolism
Module
lfu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HR49_05890
   00020 Citrate cycle (TCA cycle)
    HR49_05890
   00620 Pyruvate metabolism
    HR49_05890
Enzymes [BR:lfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     HR49_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AJK86720
UniProt: A0A1E4RAQ1
Position
complement(1174676..1176262)
Genome map
AA seq 528 aa AA seqDB search
MNSVEIANELKELLSGGNINVQLSVPQLAEKATSRGEAMLTVDGAVRAETGKYTGRSPKD
KYTVEEESTKDQIDWGKVNQPISSEVFDNLYVKVIKYLKEQDELFVFKGFAGADKDSQLS
IQVINEYAWHNLFAHQLFIRPTKDELASHVADFTVISAPNFKADPAVDGTASETFIIVSL
EKKIILIGGTEYAGEMKKSIFGIMNYLLPQQGILSMHCSANVGEAGDVALFFGLSGTGKT
TLSADPDRKLIGDDEHGWSDNGVFNIEGGCYAKTINLSAEKEPEIYNAIRFGSVLENVAV
DPETRICDYDDGSLTENTRVAYPIQYIENIVDPSVAGHPKTIIFLTADAFGVLPPISKLT
KEQAMYHFLSGFTSKLAGTERGVTEPEPVFSTCFGSPFLPLPATVYAEMLGQKIDEHGAQ
VFLVNTGWTGGEYGTGSRMKLSYTRTMVRAAIDGKLTNVETTQDAVFGLHIPTAVEGVPS
QVLNPREAWADKAAYDAKAAELAGLFNENFKKFANVSEAITTLGGPLK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagtagaaattgcaaacgaactgaaggaattattaagcggcggtaacattaac
gttcaactttcagtaccacaattagcagaaaaagctacttctcgtggtgaggcaatgtta
acagtagatggcgcagttcgtgcagaaactggcaaatacactggtcgttcacctaaagat
aaatatacagtagaagaagaaagcacaaaagatcaaattgactggggtaaggtcaatcaa
ccaatttcctctgaagtgttcgataacctgtatgtaaaagtaataaaatatttaaaagaa
caagatgaattatttgtattcaaaggctttgctggtgctgacaaagattcacaattaagc
atccaagttattaatgaatacgcttggcacaaccttttcgctcatcaattatttatccgt
ccaactaaagacgaattagcttcgcatgttgcagacttcactgtcatctcagctcctaac
tttaaagcagatcctgcggttgacggtactgcttctgaaacattcatcattgtatcactt
gaaaagaaaattatcttaattggtggtactgaatatgctggtgaaatgaaaaaatctatc
ttcggtattatgaattacttactaccacaacaaggtatcctttctatgcactgttcagca
aacgttggtgaagctggcgatgtagcattattcttcggtctatctggtactggtaaaaca
acattatccgctgatccagaccgtaagcttatcggtgacgatgaacacggctggtctgat
aatggtgtattcaatattgagggtggttgctatgcaaaaacgatcaacctttctgctgag
aaagaaccagaaatctacaatgcaatccgcttcggctctgttttagaaaacgtagctgtt
gatccagaaactcgtatttgtgattatgatgatggttcattaacagaaaatactcgtgta
gcttatccgattcaatacatcgaaaacattgttgatccttctgtagcaggtcatccaaaa
acaatcatcttcctaacagctgatgcgtttggcgtattacctcctatcagtaaattaaca
aaagagcaagctatgtatcacttcttaagtggtttcacttcaaaacttgctggaactgaa
cgtggtgtaacagagccagaaccagtattctctacatgcttcggttctccattccttcca
cttcctgcaacagtttatgcagaaatgttaggtcaaaaaattgacgaacatggcgcacaa
gtattcctagtgaacactggttggactggtggagaatatggtactggtagccgtatgaaa
ctttcttatacacgtacaatggtacgcgcagctatcgatggtaaattaacaaatgttgaa
acgacacaagatgctgtatttggtttacacatcccaacagcagttgaaggtgtaccttca
caagtgttaaatcctcgtgaagcatgggcagataaagctgcatacgatgcaaaagctgct
gaacttgcaggcttattcaacgaaaacttcaagaaatttgcaaacgtttctgaagccatc
actacacttggtggcccattaaaataa

DBGET integrated database retrieval system