KEGG   Lysinibacillus fusiformis: HR49_12015Help
Entry
HR49_12015        CDS       T03655                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
lfu  Lysinibacillus fusiformis
Pathway
lfu00010  Glycolysis / Gluconeogenesis
lfu00071  Fatty acid degradation
lfu00350  Tyrosine metabolism
lfu00625  Chloroalkane and chloroalkene degradation
lfu00626  Naphthalene degradation
lfu00680  Methane metabolism
lfu01100  Metabolic pathways
lfu01110  Biosynthesis of secondary metabolites
lfu01120  Microbial metabolism in diverse environments
lfu01130  Biosynthesis of antibiotics
lfu01200  Carbon metabolism
lfu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HR49_12015
  09102 Energy metabolism
   00680 Methane metabolism
    HR49_12015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HR49_12015
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    HR49_12015
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HR49_12015
   00626 Naphthalene degradation
    HR49_12015
Enzymes [BR:lfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HR49_12015
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     HR49_12015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N HTH_38 TrkA_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AJK90047
Position
complement(2409255..2410370)
Genome map
AA seq 371 aa AA seqDB search
MKSRAAVAFKPGEPLEIVEIDVEEPKAKEVLVKILYTSVCHTDAFTLSGDDPEGVFPAVL
GHEGAGIVIAVGDEVTLVKPGDHVIPLYTAECGECKFCRSGKTNLCSAVRETQGKGLMPD
GTTRFSYNGEPIYHYMGTSTFSEYTVVPEISLAKINKEAPLDKVGLFGCGVTTGIGAVHN
TAKVQEGAVTAVFGLGAIGLAAIQGLVQAKASRIIAIDLKEDKYELAKKMGATDFLNPSK
FDKPIQEVIVEMTDGGVDYSFECIGNVEVMRSALECCHKGWGESTIIGVAGAGKEIHTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVDDYMNGEIDIDSFITHHLNFTDINEAFDLLHKG
ESIRTMLTYGE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagtagagctgctgtggcatttaaaccaggtgagccactagaaattgtagaaata
gatgttgaagaaccaaaggcaaaagaggtattagtaaaaattctatatacttctgtctgc
catacagatgcatttaccttatcaggtgatgatccagaaggcgtatttcctgctgtacta
ggtcatgaaggtgctgggatagtcattgctgtaggtgatgaagttactttagtaaaacct
ggggaccatgttattccactatacacggctgaatgtggagaatgtaaattctgtcgttct
ggtaaaacaaacctatgtagtgcagtacgagaaactcagggtaaaggtttaatgcctgac
ggaacaactcgtttctcatataatggtgaacctatttatcactacatgggaacaagcaca
ttcagtgaatatacagtcgtgcctgaaatctctttagcgaaaattaacaaagaagcgccg
cttgataaagttggtctatttggatgcggtgttactacagggattggcgctgtacacaac
acagcaaaagtgcaagaaggagctgtgacagccgtatttggtttaggagccattggatta
gctgctattcaaggtttggttcaagcaaaagcaagccgaattattgctattgacttaaag
gaggataaatatgaattagctaaaaaaatgggtgcaactgattttctaaatccatctaaa
tttgataaaccaattcaagaagtcattgttgaaatgacggatggaggagtagattatagc
ttcgagtgtattggaaatgttgaagtaatgaggtctgctctggaatgttgtcataaaggt
tggggtgaaagtacgattatcggtgtagcaggcgcaggtaaagagattcatactcgtcca
tttcaactagtaacaggtcgagtatggcgtggttctgcctttggaggtgtgaaaggcaga
acgcagcttccaggaatggttgatgattatatgaatggtgaaatcgatatcgattcgttt
atcacacaccacttaaactttacagacatcaatgaagcatttgatttacttcataagggg
gagtccattcgtacgatgttaacatatggagagtga

DBGET integrated database retrieval system