KEGG   Lysinibacillus fusiformis: HR49_17735Help
Entry
HR49_17735        CDS       T03655                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lfu  Lysinibacillus fusiformis
Pathway
lfu00640  Propanoate metabolism
lfu00650  Butanoate metabolism
lfu00900  Terpenoid backbone biosynthesis
lfu01100  Metabolic pathways
lfu01110  Biosynthesis of secondary metabolites
lfu01120  Microbial metabolism in diverse environments
lfu01130  Biosynthesis of antibiotics
lfu01200  Carbon metabolism
lfu01212  Fatty acid metabolism
lfu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HR49_17735
   00630 Glyoxylate and dicarboxylate metabolism
    HR49_17735
   00640 Propanoate metabolism
    HR49_17735
   00650 Butanoate metabolism
    HR49_17735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HR49_17735
   00072 Synthesis and degradation of ketone bodies
    HR49_17735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HR49_17735
   00310 Lysine degradation
    HR49_17735
   00380 Tryptophan metabolism
    HR49_17735
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HR49_17735
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HR49_17735
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HR49_17735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lfu04147]
    HR49_17735
Enzymes [BR:lfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HR49_17735
Exosome [BR:lfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HR49_17735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Dodecin
Motif
Other DBs
NCBI-ProteinID: AJK88841
Position
complement(3564688..3565878)
Genome map
AA seq 396 aa AA seqDB search
MDMINEVVIVSAVRTAIGSFQGTLKDVPAVTLGSIVIKDALARAGVAGEQVDEVIMGNVL
SAGLGQNPARQAAIQAGLPHEVSALTINKVCGSGLKAVHLATQAILAGDADIVVAGGFEN
MSQAPYVLKNAREGFRMGDQKVVDTMIHDGLWCAFNDYHMGITAENLCDKYEISREEQDA
FAARSQQRAEAAIAAGKFENEIVAVEIPQRKGEPIVFAKDEFPRAGVTEESLGKLRPAFK
KDGSVTAANASGINDGAAAVVVMSKKKAQELGIQPMAIISANASAGVDPAIMGTGPVIAV
QKALAKAAATLDEIDVIEANEAFAAQSIAVDRELRFNHDKLNVNGGAIALGHPIGASGAR
ILVTLLHEMEKRDAKMGLATLCIGGGQGVATVVKRP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggacatgataaatgaggtagtaatcgtgagcgctgtacgaacagctataggctcattt
caggggacattaaaagacgtaccagctgtaactttaggtagcattgttattaaggacgct
ttagcgcgtgcaggagtagctggggaacaagtcgatgaagtcattatggggaacgtgtta
tcggctggtcttggacaaaatccagctcgtcaggcagcgatacaggctggtttaccacat
gaagtatcagcattaacaattaataaagtatgtggatcaggtttaaaggctgtgcattta
gcaacgcaggctattttagcaggtgatgctgatattgtcgtggctggtggctttgaaaat
atgagccaggcaccttatgttttaaaaaatgcgcgtgaaggcttccgaatgggcgatcaa
aaggtagtggatactatgattcatgatggtctatggtgtgcttttaatgattatcatatg
ggaattacagctgaaaatttatgtgataagtatgaaatttcaagagaagaacaggatgct
tttgcagctcgttctcagcaacgcgcagaggcagcaattgcagcaggcaaatttgaaaat
gaaatcgtcgctgttgagattccacagcgtaagggagagcctattgtattcgccaaggat
gaatttccacgtgcaggtgtaacagaggaatctctaggtaagctacgtcccgcatttaaa
aaagatggctccgtaacagcggcgaatgcttcaggcattaacgatggggcagcggcagtt
gttgtgatgtcgaagaaaaaggcacaagagcttggtattcaaccaatggcgattatttca
gccaatgcaagcgcaggagtagatcctgcaattatgggaactggtccagttatagcagta
caaaaagcactggcaaaggcagcagcaacattagatgaaatagatgtaattgaagcaaat
gaagcatttgcagcacaatcgattgctgttgatcgtgaattacgctttaatcatgataaa
ctaaatgtcaacgggggcgcgattgctcttggtcatccgatcggtgcaagtggtgctcgt
attttggtcacactcttacatgagatggaaaagcgtgatgcgaaaatgggcttagccacg
ttatgtatcggtggtggtcaaggggtagctacagtagtgaagcgtccttga

DBGET integrated database retrieval system