KEGG   Lysinibacillus fusiformis: HR49_23570Help
Entry
HR49_23570        CDS       T03655                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lfu  Lysinibacillus fusiformis
Pathway
lfu00450  Selenocompound metabolism
lfu00970  Aminoacyl-tRNA biosynthesis
lfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HR49_23570
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HR49_23570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lfu01007]
    HR49_23570
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lfu03016]
    HR49_23570
Enzymes [BR:lfu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HR49_23570
Amino acid related enzymes [BR:lfu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HR49_23570
Transfer RNA biogenesis [BR:lfu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HR49_23570
 Prokaryotic type
   Other AARSs
    HR49_23570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 zf-Mss51 Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: AJK89882
Position
complement(4785243..4787219)
Genome map
AA seq 658 aa AA seqDB search
MSEQKKTFYITTPIYYPSGKFHIGTAYTTVASDAIARYKRLRGYDVRFLTGMDEHGQKIQ
EKAAEAGKHPQDYVNEIAEAAKKLWALMDISYDDFIQTTQERHTKAVEKIFQKFLDNGDI
YKGEYEGWYCTPCESFFTETQLVDGNCPDCGRPVHKVKEESYFFNMKKYADRLLSYYEEN
LGFIEPESRKNEMINNFIKPGLEDLSVSRTSFDWGIKVPGDPKHVIYVWVDALTNYITSL
GYLSDDETLFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKDGK
MSKSKGNVIYPEMLIERYGLDATRYFLLRELPFGSDGVFSPESFIERTNFDLANDLGNLL
NRTISMINKYYDGIIPSENLQSTEFDTALKEQAESVRIKYEESMEKMQFSVVLADLWTLV
SRTNKYIDETQPWVLAKEEADKPKLGSVMRNLAESLHQIAVMLQPFMTTTPKRMMEQLGL
DDKFLAWDTIETFGNTIPANIKVVEKGIPIFPRLENEVEIAYIREEMRGSVKTSQEEEVK
SETKSDGNPEIPEITIDDFMKIDLRVATVTACETVPKADKLLKLQVDLGYEQRQVVSGIA
KFYSPDELVGQKVIVVANLKPVKLRGELSQGMILAGEKDGILKLASVDSKLENGAKVK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaacaaaagaaaacattctatataacaacacccatttactatccaagtgggaag
tttcatattggtacggcatatacaacagttgcatcagatgcgatagcacgttataaacgt
ttacgtggttatgatgttcgttttttgacaggtatggacgagcatggacaaaaaattcaa
gagaaggcagcagaagcgggcaaacatcctcaggattatgtcaatgaaattgcagaggct
gcgaaaaagctttgggcgttaatggatatttcttacgatgattttattcaaacaacgcaa
gaacgacatacaaaagctgtcgaaaagattttccaaaagtttttagataatggagatata
tataaaggtgagtatgaaggctggtattgtacgccttgtgaatcattctttacagagact
caactagttgatggaaattgtccagactgtggtcgccccgtccataaagtaaaagaagaa
tcgtacttctttaatatgaagaaatacgcggatcgtttattgtcttattatgaggaaaac
cttggatttattgaaccggagtctcgaaaaaatgaaatgatcaataactttattaaaccg
gggttagaagatttatcagtatcgagaacatcctttgactggggtattaaagtacctggg
gatcccaaacatgttatctatgtatgggtagatgcattaacgaattatattacatcatta
ggatatctttcagatgatgaaacattattcaacaaatattggccagcagatgtgcatgta
gtagggaaagatatcgttcgcttccatacaatatattggccaattttcttaatggcttta
gatttaccattaccaaaaaaggtttttgctcatggttttattatgatgaaagacgggaaa
atgtctaaatcaaaaggtaatgtcatttatccagaaatgttaatcgaacgttatggcctt
gatgcaacacgttatttccttttacgcgaattaccttttggttcagatggagtattctct
ccagaatcatttattgaacgcacaaactttgatcttgcaaatgatttaggtaatttatta
aaccgtactatttcgatgattaacaaatattacgatggcattattccttcagagaatctt
caatcgacagaatttgatacagcattaaaagagcaggctgagtcggtacgtattaaatat
gaagaaagtatggaaaaaatgcaatttagtgtggtattggcagacttatggacattagta
tcacgcacgaataagtatatagatgaaacacaaccatgggtattagcaaaagaagaagcg
gataaaccaaaattaggttcagtaatgcggaatttggcagaaagcttacatcaaattgcg
gtcatgttacaaccatttatgacaacaacacctaaacgtatgatggaacagcttggtttg
gatgacaaattcttagcatgggatacaattgaaacattcggcaatactattccagcaaac
attaaagtggtagaaaaagggatacctattttccctcgtttggaaaatgaagttgaaatt
gcttatatccgtgaagaaatgcgtggttcagtaaaaacttcacaagaagaagaagttaaa
agtgagacaaagagtgatggaaacccagaaattcctgaaattactattgatgatttcatg
aaaattgatttgcgtgttgcgactgtaactgcttgtgaaacggtgcctaaagctgataaa
ttattaaagcttcaagtcgacctaggatacgagcaacgccaagtagtttcaggtattgcg
aaattctattctccagatgaattagttggtcaaaaagtgattgtcgtagccaacttaaaa
ccagttaaattacgtggtgaattatcacaaggtatgatcctagccggtgaaaaagatggg
attttaaaattagcatctgtagattcaaaacttgaaaatggtgcaaaagtaaagtaa

DBGET integrated database retrieval system