KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0588
Entry
LGAS_0588         CDS       T00410                                 
Name
(GenBank) hypothetical protein
Organism
lga  Lactobacillus gasseri ATCC 33323
SSDB
Motif
Pfam: zf-CCCH_4 DUF3290
Other DBs
NCBI-ProteinID: ABJ59984
UniProt: A0A805YZQ8
Position
609570..609833
AA seq 87 aa
MEIIDNRTKKEEWRLGDVLVSGSAQLTGLIVKDNNGKYCLIDITPDESGNYSTMEGCYYG
DSCENLAELYCKMGPNWHKVNAKLVIE
NT seq 264 nt   +upstreamnt  +downstreamnt
atggaaattattgataatcgcacaaagaaagaagagtggcgcttgggtgatgtacttgta
tctgggagcgctcaattaacaggcttaattgtaaaagataacaatggaaaatattgctta
atagatattactcctgacgaatctggaaactacagcaccatggaaggttgttactatggc
gatagttgtgaaaatttagcagaactttattgcaaaatgggtcccaattggcacaaagta
aacgcaaagctggtgatcgaatga

DBGET integrated database retrieval system