KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0646
Entry
LGAS_0646         CDS       T00410                                 
Name
(GenBank) Transcriptional regulator, xre family
Organism
lga  Lactobacillus gasseri ATCC 33323
SSDB
Motif
Pfam: HTH_19 HTH_25 HTH_3
Other DBs
NCBI-ProteinID: ABJ60040
UniProt: A0A805ZGF1
Position
647958..648263
AA seq 101 aa
MQNRLKKLRLEKRLTLADIQAKTNIDFRILENFEKGLENGIHNSLAIWQKLANFLEVPIE
YLMGLNDDSKTLTVNDLNPAKEDAYERITDMLCEDEDDEDE
NT seq 306 nt   +upstreamnt  +downstreamnt
atgcaaaataggctaaagaaattgagattggaaaagagattaactcttgccgatatacaa
gctaaaaccaacattgattttagaattttagaaaatttcgaaaaaggattggaaaatgga
atacataactctttagcaatttggcaaaagttggctaactttttagaagttccaattgag
tacctaatgggattaaacgacgatagcaagacattaactgttaacgacttgaacccagcc
aaagaagatgcttacgagcgtattacggatatgctatgcgaagatgaggacgatgaagat
gaataa

DBGET integrated database retrieval system