KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0417Help
Entry
LGAS_0417         CDS       T00410                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga00030  Pentose phosphate pathway
lga00480  Glutathione metabolism
lga01100  Metabolic pathways
lga01110  Biosynthesis of secondary metabolites
lga01120  Microbial metabolism in diverse environments
lga01130  Biosynthesis of antibiotics
lga01200  Carbon metabolism
Module
lga_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LGAS_0417
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LGAS_0417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lga04147]
    LGAS_0417
Enzymes [BR:lga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     LGAS_0417
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     LGAS_0417
Exosome [BR:lga04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LGAS_0417
  Exosomal proteins of colorectal cancer cells
   LGAS_0417
  Exosomal proteins of bladder cancer cells
   LGAS_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABJ59822
Position
443780..445228
Genome map
AA seq 482 aa AA seqDB search
MENIPVVMIIFGGSGDLAHRKLYPALFNLYQKGLIHDHFSVIGTARRPWSHEYLQEQVVE
AIKESNSSFDEKDAKEFASHFYYQSHDVTDVDHYIALKELATKLDKKYHAEGNRIFYMAM
APRFFGTIATHINDQKLVGSGFNRLVIEKPFGHDLASAEKLNQEISESFAEDSVYRIDHY
LGKEMVQNIMPLRMTNPIVNNIWCKKYIANMQVTLAESLGVGTRGGYYETSGALRDMVQN
HIFQIITLLAMPEPKALDSDHIHEAKQELLDSLVIPTPEMVKQHFSRGQYLASDDEVEYL
KADQVAPDSKVETFVAGEVNFKKGPVAGVPIYFRTGKKMKDKVSRIDIVLHHMNNLYGNA
HSNNISIIIDPRSEIFFTINGKKITTEGLRRENLSYKFSKEEMAQVPDGYERLLHDVFVA
DRTNFTHWSELKQYWKFVDAVEAAWQDENKDIKQLEQYPSGEFGTESSNHIFEKDTEHWI
YR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatattccagttgtcatgattatttttggtggctcgggtgatttagctcataga
aagctttatccagccttattcaacttatatcaaaagggattaattcatgatcatttttcc
gtaattggtacagctagaagaccatggagtcatgaatacttacaagaacaagttgttgaa
gcaattaaagaaagcaacagcagctttgatgagaaagatgcaaaagaatttgcttcgcat
ttttattaccaatcacatgatgtaactgatgttgatcactacattgctctaaaagaatta
gctacaaagcttgataagaaatatcacgcagaaggcaaccgtattttctacatggcaatg
gcaccaagattttttggcacaattgcaacccatattaacgatcaaaagctagttgggagt
ggttttaaccgcttggtaattgaaaagccatttggtcatgatctagcttctgctgaaaaa
ttaaatcaagaaattagcgaaagttttgctgaagattcggtatatcgaattgaccattat
ctcggcaaagagatggtccaaaatattatgccgcttagaatgactaatccaattgttaat
aatatttggtgcaagaaatacattgctaatatgcaagttacccttgctgaaagcttaggc
gttggtactcgtggcggatattatgagacttctggtgctttacgcgatatggttcaaaat
catatttttcaaattattacccttttagccatgccagaacctaaagccttagattcagat
catattcatgaagcaaagcaagaactactcgatagtttggtcattccgactccagaaatg
gtaaagcagcatttctcacgtggtcaatatttagcaagtgatgatgaagtggagtattta
aaggccgatcaagttgctcctgattctaaagtagaaacttttgttgctggcgaagttaac
ttcaagaagggtcccgtagctggtgttccaatctactttagaaccggtaagaagatgaaa
gacaaagtttctagaatcgatattgtactccaccacatgaataatttatacggcaatgca
cattcaaataatatttcaattattattgatccaagaagcgagattttctttactattaac
ggaaagaagattactactgagggcttaagaagagaaaatctcagctataagttctctaag
gaagaaatggctcaagtcccagatggctacgaaagattacttcacgatgtctttgtagct
gatcgtacaaactttacgcactggtctgaattaaagcaatactggaagtttgttgatgcg
gttgaagctgcatggcaagatgaaaataaagatattaagcaacttgagcaatatccaagt
ggtgaatttggtactgaatcgagtaaccatatttttgaaaaagatactgaacactggatt
taccgttaa

DBGET integrated database retrieval system