KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0702Help
Entry
LGAS_0702         CDS       T00410                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga00040  Pentose and glucuronate interconversions
lga00052  Galactose metabolism
lga00500  Starch and sucrose metabolism
lga00520  Amino sugar and nucleotide sugar metabolism
lga01100  Metabolic pathways
lga01130  Biosynthesis of antibiotics
Module
lga_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LGAS_0702
   00052 Galactose metabolism
    LGAS_0702
   00500 Starch and sucrose metabolism
    LGAS_0702
   00520 Amino sugar and nucleotide sugar metabolism
    LGAS_0702
Enzymes [BR:lga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LGAS_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABJ60094
Position
685345..686253
Genome map
AA seq 302 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKAMPKEMVPIVDKPTIQFIVEEAKKSGIEDILIVTGKNK
RSIEDHFDANPELEQDLEEKGKTELLHLTQSITNLGVNLYYTRQPHPAGLGDAILRARSF
VGDEPFAVMLGDDLMDDKVPLTKQLIDRYDKTHASTIAVMPVPHEEVSKYGVIDPDNEIE
PGLINVKAFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFNGERHDVGNKEGYLETSIEYGLSHPQIKDDLRKYIIAMGQKLQNEDKKTNK
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagcagttattccagcagctggattaggtactagatttttacctgca
actaaggctatgcctaaggaaatggtaccaattgttgataaaccaacaattcaatttatc
gtagaagaagctaaaaaatcaggaattgaagatatcttgattgttactggtaagaacaag
cgctcaattgaagatcactttgacgctaacccagaactagaacaagatttggaagaaaag
ggtaagactgaacttttacacttgacccaatcaattactaatttaggtgttaacctttac
tacactcgtcaaccacatccagctggtttaggagatgcgattttaagagctcgcagcttc
gttggggatgaaccatttgctgttatgcttggtgacgacttaatggacgacaaggttcca
ctaactaagcaattaattgatcgctacgataagacacatgcatcaactattgctgttatg
cctgtaccacatgaagaagtttctaagtacggtgttatcgatccagataacgaaattgaa
ccaggcttgattaacgttaaagcctttgttgaaaagccagatgttgataaagctcctagt
gattacgcaatcattggtcgttacttattaactccagaaatttttgatattttagcacat
caaaaacctggtcgtggtggcgaaattcaattaactgacgctattgatactatgaacaag
actcaacgagtatttgctcatgtatttaacggtgaacgtcacgatgttggtaacaaggaa
ggttaccttgaaacctcaattgaatatggtttatctcacccacaaattaaagatgattta
cgtaagtacatcattgcaatggggcaaaaattacaaaatgaagataaaaagactaataag
aaaaaataa

DBGET integrated database retrieval system