KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0751Help
Entry
LGAS_0751         CDS       T00410                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga00670  One carbon pool by folate
lga01100  Metabolic pathways
lga01120  Microbial metabolism in diverse environments
lga01200  Carbon metabolism
Module
lga_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LGAS_0751
Enzymes [BR:lga01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     LGAS_0751
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     LGAS_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABJ60142
UniProt: Q044I0
Position
729155..730003
Genome map
AA seq 282 aa AA seqDB search
MKKLLEGKTPANEITENLKKEIKNLKNDGINPTLCVIEVGDDPASKIYLRVKRNLAKKVG
INEVGLHFPADTSQAELLGKIKELNQDPNINGIMVQLPVPPQIDPRAIFETIAPEKDADG
FSPLNLGRLWEGQSDIIPATVRSILTLIDYYGIKMAGKNTVIIGRSVIVGKPLAAVLLER
DATVTIAHSKTKNLADLTRNADVIISDVGKAHLVTEDMVKDGAVLIDVGMNRENGKLMGD
VDFDTVAPKANAITPVPGGVGPLTVASLMKQAVILTRKQHGR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaattactagaaggaaaaactcctgcaaatgagattacagaaaatttgaaaaaa
gaaataaaaaatttgaaaaatgacggaataaatccaactttatgcgtaatagaagttgga
gacgatcctgcaagtaaaatttatttgcgagttaaaagaaatttagctaaaaaagtaggt
atcaatgaagttggattgcattttccagctgatacttctcaagctgaacttctaggaaag
attaaggaacttaatcaagatccaaatattaatggtattatggttcaattaccagttcca
cctcaaattgatccgagagctatttttgaaactattgctcctgaaaaagatgctgatgga
ttttctccacttaatttaggccgtctttgggaaggacaaagtgatattattccagcaaca
gttcgtagtattctaacattgattgattattatggaattaagatggccggaaagaataca
gtgattattggtcggagcgtaattgttggtaagccactagctgctgttttacttgaacga
gatgcaactgtaactattgctcattcaaagactaagaatctggcagatttgacaagaaat
gctgatgtaatcatttctgacgtgggtaaagctcatttagtaactgaagatatggtaaaa
gatggagcagttttgattgatgttggaatgaaccgtgaaaacggtaaattaatgggtgat
gtagattttgatacagtagctcccaaggctaatgcaattacaccagttccaggaggagtt
ggcccattgacagttgctagtttaatgaaacaagcagtgattttaacgaggaaacagcat
ggcagataa

DBGET integrated database retrieval system