KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0845Help
Entry
LGAS_0845         CDS       T00410                                 

Definition
(GenBank) ABC-type metal ion transport system, ATPase component
  KO
K02071  D-methionine transport system ATP-binding protein
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lga00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LGAS_0845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lga02000]
    LGAS_0845
Transporters [BR:lga02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   D-Methionine transporter
    LGAS_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran NIL SMC_N AAA_21 AAA_22 AAA_29 RsgA_GTPase AAA_16 RseA_C AAA_23
Motif
Other DBs
NCBI-ProteinID: ABJ60234
UniProt: Q043Y8
Position
831595..832644
Genome map
AA seq 349 aa AA seqDB search
MTAQINLKDITVQFGPNKAVNNVNLEINKGDIYGVIGFSGAGKSTLVRTINLLQYPSAGS
VEVNGTILFKEGKLQVSKKQLQEKRRKIGMIFQNFNLLNEETVIENVAFALQHTHLSDKE
LEEKSLHLLELVGLKDKSDFYPAQLSGGQRQRVAIARALANDPDILISDEATSALDPKTT
NQILDLLYDLNKKLGLTIVLITHEMDAVKRVANKIAVMEKGKVIEKGDLREVFLHPQKQL
TRQFVGGALQAQHILNTYNFDKLADNAELYQLVYSINDVTKSVVADLDVSLNTKASILYG
NVEVLSGEPIGTLAILLNLDEQKQKEAIKFLESKNVVVTKLDKGVLTND
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacaaattaatttaaaagatatcactgttcaatttggaccaaataaggcagtt
aataatgtgaatctagaaataaataagggcgatatttatggtgtgattggtttctccggt
gcgggaaaatccaccttggttagaacaattaatttactacaatatccttcggctggttct
gtcgaagttaacgggacaattttattcaaggaaggtaaacttcaggtttctaaaaagcag
cttcaagaaaaaagacggaaaattggaatgattttccaaaattttaatcttttaaatgaa
gaaaccgtaattgaaaatgttgcttttgcgttgcagcatacgcatttgtctgacaaagaa
ttagaagaaaaatcacttcatttattagaattggtaggtttaaaagataaatctgacttt
tatccagcacaattatctggtggtcaaagacaacgtgtcgcaattgcgcgtgctttagct
aatgatcctgatattttgatttctgatgaagcaactagtgcccttgaccctaaaactact
aatcaaatcttagatttgctttatgatttgaataaaaaattaggattaacgattgtctta
attacacatgaaatggatgcagtaaaaagagttgcaaacaaaatcgctgtcatggaaaaa
ggaaaagtaattgaaaagggagatttgagagaagtcttcttgcatcctcaaaagcagctt
acacgtcaatttgtaggtggcgctttgcaggctcaacatattttaaatacgtacaacttt
gataaattggcagataatgcagaattatatcagttggtttatagcattaatgatgttact
aagtcagtagttgccgatttagatgtttcattaaatactaaagcaagtattttgtatgga
aatgtagaagtcttaagtggtgaaccaattggcacacttgctattttattgaaccttgat
gagcagaaacaaaaagaggcaattaaatttttagagagtaaaaacgttgtagtaacgaaa
ttagataaaggagtgctgactaatgattag

DBGET integrated database retrieval system