KEGG   Lactobacillus gasseri ATCC 33323: LGAS_1016Help
Entry
LGAS_1016         CDS       T00410                                 

Definition
(GenBank) Formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga00670  One carbon pool by folate
lga01100  Metabolic pathways
lga01120  Microbial metabolism in diverse environments
lga01200  Carbon metabolism
Module
lga_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LGAS_1016
Enzymes [BR:lga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     LGAS_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS GTP_EFTU RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABJ60392
UniProt: Q043I0
Position
complement(1018336..1020015)
Genome map
AA seq 559 aa AA seqDB search
MNLKSDIEIAQNTKELPIKEIAQKIDLRPEEIELYGNDKAKISWKGINCIKKNQKLGKLI
LVTSISPTPAGEGKSTITIGLGDAIRNQLHKNTLIALREPSMGPVFGLKGGATGGGYAQI
IPMEDINLHFTGDMHALTSAIDTLAALVDNYIYQDNSLELDPNRILLKRGIDVNDRTLRK
ITIGQGSRFNGIEHEASFAITVANELMAILCLATDINDLKKRIGNILVGFSVKDEPVYVK
DLGFEGAIAALLSTALKPNLVQTLEHTPAIVHGGPFANIAHGANSVIATNTALHLSDYVL
TEAGFGADLGGQKFMDFVSNHLDKRPDAVVVVATVRALKYQAEESTDHLDEENIPALEKG
FANLKRHMENMAHYGVPVIVLINKFASDTDQELNKLKELVQDDGFECEIVSYHDEGSKGG
IQAAEKVVELTGKASDFKPVYKPEDSVEDKIAKIAHKIYHAKDIEYSDTAKKQLAEIKKM
GKDELPVIIAKTQYSFTDKKKILGAPEDFILHVKDLALKNGAGFIVVATGSILDMPGLPK
HPAALDIDVDNNGKISGLF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaagtcagatatcgagattgctcagaatactaaagaattaccaattaaagaa
attgcacaaaaaattgaccttcggccagaggagattgaactttatggcaatgataaagct
aagattagctggaagggtattaattgcattaagaagaaccaaaaacttggaaagttaatc
ttagttacgtcaattagtcctactcctgctggtgaaggaaaatcgactattactattggt
ttgggggatgctattcgcaaccaactccataaaaacactttaattgctttaagagagccc
tcaatgggtcctgtttttggattaaagggtggagctaccggtggtggatatgcacaaatc
atcccaatggaagacatcaatttgcattttacaggagatatgcatgctttaactagtgca
attgatactttagctgctttagtcgataattatatttatcaagacaatagtctagagtta
gatccaaatcgtattttgttaaaacgcggaattgacgttaatgatcgtactttaagaaaa
atcactatcggtcaaggatcacgttttaatggaatcgaacatgaagctagctttgcaatt
actgtagcaaatgaattaatggctattttgtgtttagcaactgacattaatgatttaaag
aagagaattggaaatattcttgttggcttttctgtcaaagatgaacctgtttatgttaaa
gacttagggtttgaaggagcaattgctgctttattatcaactgcattaaagcctaaccta
gttcaaacgcttgaacatactccggcaattgtacacgggggaccatttgcaaatatcgct
catggtgctaattcagtaattgctactaacacagccttacatttaagtgattatgtttta
actgaggcaggttttggcgcagaccttggtgggcaaaagtttatggactttgtatcaaac
cacttagataaacgtccagatgctgttgtagtagtagcaactgtaagagcattaaagtat
caagctgaagaaagcacagatcatttagatgaagaaaatatccctgctttagaaaaggga
tttgctaacttgaagcgtcatatggaaaatatggctcattatggtgttccagtaattgtc
ttgattaataagtttgccagtgatactgaccaggaattgaacaaattaaaagaattagtt
caagatgatggctttgaatgtgaaattgtttcttaccatgatgaaggttcaaagggagga
atccaagcagctgaaaaggttgttgagttaactggtaaagctagtgactttaagcctgtt
tataagccagaagattctgtagaagataagatcgccaaaattgctcataagatctatcat
gccaaggatattgaatattctgatacggcaaagaaacaattagcagaaattaagaagatg
ggcaaagatgaattaccagtgattattgctaaaacgcagtatagttttaccgataaaaag
aagatccttggagctccagaagattttattctccatgttaaagatcttgcgcttaaaaat
ggggctggctttattgtggtagcaactggttcaattttagacatgccgggccttcctaaa
catcctgctgctttagatattgatgtagacaataatggaaagatttcgggattattctaa

DBGET integrated database retrieval system