KEGG   Lactobacillus gasseri ATCC 33323: LGAS_1561Help
Entry
LGAS_1561         CDS       T00410                                 

Definition
(GenBank) acetaldehyde dehydrogenase / alcohol dehydrogenase AdhE
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga00010  Glycolysis / Gluconeogenesis
lga00071  Fatty acid degradation
lga00350  Tyrosine metabolism
lga00620  Pyruvate metabolism
lga00625  Chloroalkane and chloroalkene degradation
lga00626  Naphthalene degradation
lga00650  Butanoate metabolism
lga01100  Metabolic pathways
lga01110  Biosynthesis of secondary metabolites
lga01120  Microbial metabolism in diverse environments
lga01130  Biosynthesis of antibiotics
lga01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGAS_1561
   00620 Pyruvate metabolism
    LGAS_1561
   00650 Butanoate metabolism
    LGAS_1561
  Lipid metabolism
   00071 Fatty acid degradation
    LGAS_1561
  Amino acid metabolism
   00350 Tyrosine metabolism
    LGAS_1561
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LGAS_1561
   00626 Naphthalene degradation
    LGAS_1561
Enzymes [BR:lga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LGAS_1561
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LGAS_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABJ60911
Position
complement(1551356..1553965)
Genome map
AA seq 869 aa AA seqDB search
MVQDKKATKEEKTIDVNKMIDGYVEKAHVALDEMADFDQEQVDKICEAIASAGEQNSYLL
AKMAVEETGRGVVEDKTIKNMFASENIWNSLRHEKTVGVIEEDKEKQLVKIAEPKGVIAG
VTPVTNPTSTVIFKAMLALKTRNAIIFGFHPQAQKSCVKTGEIIREAAVKAGAPKDAIQW
IEYPSLEATSALMNHPNVQTILATGGPGMVKAAYSSGKPAIGVGPGNGPSYIEKTANIPE
SVYDIVLSKTFDNGMICSSENSVVVDEEIYNKVKDEFKSWNCYFLKPDEIKKFEEKFIDP
RRGTVAGPVAGRSAYQIAKLCGVDVPEDTKVIIAEYKGVGKKYPLSAEKLSPVFTMYKAK
DHEDAYKICTDLLNYGGRGHTAGVHSQDEKVIDDFSMKMDACRILVNSPASVGGVGDLYN
NMLPSLTLGTGSYGANTFSHNIGARDLLNIKTVAKRRDNMQWIKVPKKTYFEHNAANYLK
HMPDVERFFIVTDEGVASKYINEITDIISQRRGKKSYEVFQAVTKDPDTTIIADGVHRMN
IFKPDVVIAVGGGSVMDAAKAMRLFYENPDMSFADAYSKFLDIRKRTVRFPKYNAIQLVC
IPTTSGTGSEVSPFSIIKDTVTGIKHTLCDYSLNPDVAIVDDQFVETMPKELIARSGFEA
LAHAVESYVSTMATDFTRGWSMEAIKLIFENLEKSYNGDQSARSRMHNAATLAGMAYANA
FLGVGHAIAHTESSEFGIPSGLSDAIAMPYVIRFNSKKPRKLAMRPHYSTFRADKDYAAI
ARSLGLKGNTDQELVDSLIKKIVELGHGVGLNLSLKANGVSEADFNNKVDAMAVEAYGDQ
NVVTNPSALLISEIKDLMKETYKGKGIEA
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagataaaaaggctacaaaagaagaaaaaacaattgatgtaaataaaatgatt
gatggttatgttgaaaaagctcacgttgctttagatgagatggccgatttcgatcaagaa
caagttgacaaaatatgtgaggctattgcaagtgctggagagcaaaatagttaccttctt
gcaaaaatggcagttgaggaaactggtcgtggtgtagtagaagacaaaacgatcaagaac
atgttcgctagtgaaaatatttggaacagtcttcgccacgagaaaactgtaggtgttatt
gaagaagataaggaaaagcaattagtcaaaattgctgaacctaagggtgtaattgctgga
gtaactccagttactaacccaacttcaactgtaatttttaaggcaatgcttgctttgaag
actagaaatgctattatttttggcttccacccacaagcacagaagagctgtgtaaaaact
ggtgaaattattcgtgaggctgcagttaaggcaggtgcacctaaagatgccattcaatgg
attgaatatccaagtcttgaagcaactagtgctttaatgaatcatccaaatgttcaaact
attttagctactggtggtcccggaatggttaaagcagcttattcatctggtaagcctgct
attggtgttggtcctggtaatggtccatcctatattgaaaagactgctaatattccagag
tctgtttatgacattgttttgtctaaaacctttgataatggaatgatttgttcatctgaa
aattctgtagtagttgatgaagaaatttacaacaaggtaaaagatgaatttaagtcttgg
aactgctacttcttgaaaccagatgaaatcaaaaaatttgaagaaaagtttatcgatcct
agaagaggaacagttgctggtccagttgcaggacgttcagcttatcaaattgctaagtta
tgtggcgtagatgttccagaagataccaaagtaatcattgctgaatataagggggtaggt
aaaaagtatcctttatcagctgaaaaactttcaccagtatttactatgtacaaggctaag
gatcatgaagatgcttataagatttgtactgatcttctaaactatggtggtcgtggacat
actgctggagttcactcacaagatgaaaaagttattgatgacttttcaatgaaaatggat
gcatgtcgtatcttagtaaactctcctgcttcagttggtggggtcggtgatttatacaat
aatatgcttccttctcttactttgggaactggttcatacggagcaaatactttctcacat
aatattggtgctagagacttgcttaatattaagaccgttgcaaagcgtcgcgataatatg
cagtggattaaagtaccaaagaagacgtattttgaacataatgctgcaaattacttaaag
catatgccagatgttgaaagatttttcattgtgactgatgaaggcgtagcaagtaagtac
attaatgaaattaccgatatcattagtcaacgtcgtggaaagaagagctatgaagtcttt
caagcagtaactaaagatccagatactactataattgctgatggtgttcacagaatgaat
atctttaaaccagatgtagttattgctgttggtggtggttcggtaatggatgctgctaaa
gcaatgcgcttattctatgaaaatccagatatgagttttgctgatgcttattcaaaattt
ttggacattagaaaaagaacagtaaggtttccaaaatataatgccatccaattagtatgt
attccaactacttcaggcactggctcagaagtgtcaccattttctattattaaagatact
gtaactggcattaaacatactctttgtgactattctttaaatcctgatgttgcaattgtt
gacgatcaattcgtagaaacaatgcctaaagaattgattgcacgttctggttttgaagca
ttggctcacgcagtagaaagttatgtttctacaatggctactgactttactcgtggctgg
tcaatggaagctattaagttgatttttgaaaacttggaaaaatcatataatggtgatcaa
agtgcaagaagtagaatgcataatgcagctactttagctggaatggcatatgctaatgcc
ttcttaggagtaggacatgcaattgctcatactgaatcatctgaatttggtattccaagt
ggcttgagtgatgcaatcgctatgccatacgtaattagatttaattctaagaaaccaaga
aaacttgctatgcgtccacactattcaacttttagagctgataaggattatgctgcaatt
gctcgtagcttaggcttaaagggtaacactgatcaagagttagtggattccttaattaag
aaaattgtcgaattaggtcacggtgtaggactgaaccttagtcttaaagctaatggagtt
agcgaagctgatttcaataataaagttgacgctatggctgttgaggcttatggagatcaa
aatgtcgtaactaatccttccgctttgttgattagtgaaattaaagacttaatgaaagaa
acttataagggaaagggtattgaagcctag

DBGET integrated database retrieval system