KEGG   Lactobacillus gasseri ATCC 33323: LGAS_1761Help
Entry
LGAS_1761         CDS       T00410                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
Organism
lga  Lactobacillus gasseri ATCC 33323
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF900
Motif
Other DBs
NCBI-ProteinID: ABJ61049
Position
complement(1746522..1747148)
Genome map
AA seq 208 aa AA seqDB search
MDLLLVRHGISEHNTSDVISGGTSNPNLSQAGVKQVEEISKIIDNNKIDQVYASPLIRAK
RTAQILTDFQKDIITDDRLKEMDFGSWEGQHAEGLKVKYPDAFDDLGTINSKYTKYAKDG
ETFEQVADRVEDFLAEIQPNSNDKTIMVVCHGFVIRSLIARWFKLKIEDVMTVRNVSFTE
LHFEKDDVERPRLMTFNRTEPLYYGTKR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatttgttattagtaagacatggaattagtgagcacaatacttcagatgtaatctcc
ggcggtactagtaaccctaacttaagccaagctggtgttaagcaagtagaagaaataagt
aaaataattgataataataaaattgatcaagtctatgctagtcccttaattcgtgctaaa
agaacggcgcaaattttaactgattttcaaaaagatattattactgatgaccgtcttaaa
gaaatggattttggttcatgggaaggtcaacatgcggaaggattgaaggtgaaatatccc
gacgcattcgatgatttagggactattaatagcaaatatacaaaatatgctaaagatggc
gaaacttttgagcaagtggctgatcgagttgaagattttttagctgaaattcaaccaaat
tctaatgacaaaacgattatggttgtctgtcacggatttgtaattaggagtttaatagct
agatggtttaaactaaaaattgaagatgtaatgacggtcagaaatgttagttttactgaa
cttcattttgaaaaagatgatgttgagcgaccacggttgatgacatttaatcggacggag
cctttatattacggaactaagaggtaa

DBGET integrated database retrieval system