KEGG   Lactobacillus gasseri ATCC 33323: LGAS_1857
Entry
LGAS_1857         CDS       T00410                                 

Definition
(GenBank) Predicted sugar phosphate isomerase
  KO
K07106  N-acetylmuramic acid 6-phosphate etherase [EC:4.2.1.126]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga00520  Amino sugar and nucleotide sugar metabolism
lga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LGAS_1857
Enzymes [BR:lga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.126  N-acetylmuramic acid 6-phosphate etherase
     LGAS_1857
SSDB
Motif
Pfam: SIS SIS_2 UBA_4 ANTAR
Other DBs
NCBI-ProteinID: ABJ61131
UniProt: Q040J1
Position
1848449..1849342
AA seq 297 aa
MEIKNLTTEQRNPATMHIDSMSTIDMVKTINKEDQKVAVAVGTQDDKIAQAIDEAAKRYS
KGGRLIYIGAGTSGRLGVLDAAELVPTYGIKPERAIGLIAGGKGAMYVAVEGAEDSQDLA
KRDLKDLKLNKNDIVLGLAASGRTPYVIGGLDYAKAIGALTISIACVKDSKIGHHADIAI
EAVVGPEAITGSTRMKAGTAQKMILNMISTGVMIKQGKVFENVMIDVKPTNSKLIDRACR
IIQTTTGVSTPEARNTLEKANNDVGLAIVMLKTNSDLNQAKNLLKAENGNVAEVLNK
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaaattaaaaacttaactacggagcaacggaaccccgcgactatgcacattgattcc
atgtcaactatcgacatggtcaaaactattaataaagaagatcaaaaagtcgctgtagca
gtcggaactcaagacgacaaaattgcccaggcaatagatgaggcagctaagcgctatagc
aaaggtggacgtttaatctatatcggtgctggaacaagcggccgtcttggcgttttagat
gctgccgaattagttcctacctacggtatcaaaccagaacgcgcaatcggattaattgct
ggcggtaaaggtgcgatgtatgttgctgtcgaaggtgctgaagattcacaagatctagca
aaaagagatttaaaagatcttaaactaaataaaaacgatatcgtcttagggcttgctgcc
agtggccgcactccatatgtaattggcggtcttgactatgctaaagccataggtgctcta
actatttccattgcctgtgttaaagactctaagataggccatcacgccgatatagctatt
gaagctgttgttggacctgaagcgattaccggttcaactaggatgaaagccggaactgct
caaaagatgattttgaatatgatttctaccggtgtcatgattaagcaaggaaaagtcttt
gaaaatgtcatgattgatgttaaacctactaattctaagctaattgatcgtgcctgtcgc
attattcaaactactactggtgtatctaccccagaagctagaaatactcttgagaaggcg
aataatgatgttggtttagcaattgtgatgctgaaaactaattctgatcttaatcaggct
aaaaacttattaaaagcagaaaacggaaatgtcgcagaagttttaaataagtag

DBGET integrated database retrieval system