KEGG   Leuconostoc garlicum: A9176_01265Help
Entry
A9176_01265       CDS       T04802                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00430  Taurine and hypotaurine metabolism
lgc00620  Pyruvate metabolism
lgc00640  Propanoate metabolism
lgc00680  Methane metabolism
lgc01100  Metabolic pathways
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
Module
lgc_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9176_01265
   00640 Propanoate metabolism
    A9176_01265
  09102 Energy metabolism
   00680 Methane metabolism
    A9176_01265
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    A9176_01265
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     A9176_01265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase DUF150_C
Motif
Other DBs
NCBI-ProteinID: AQN79112
Position
complement(262643..263905)
Genome map
AA seq 420 aa AA seqDB search
MAKTMAVNAGSSSLKFQLLEMPAEQVLAQGLIERIGMDDAIVTIKYDAKAMNQGGRLDDQ
SVDDSNITISKDGQTRKYETVLPIKDHQQAINFMLQKLTDLGIIVDFNEITGVGHRVVAG
GEWFNHSVKVTKAVLEKIDRLADYAPLHNPANAMGIRAFQKLLPDAVSVAVFDTSFYQTM
PEENYLYAIPYQYYTRYGARKYGAHGTSHRYVANRAADMLRQPLKDLKVITMHLGAGDSI
TAVKDGKALDTSMGFTPLAGVAMATRSGDVDTSLIYYIQEREGLTNDQMLNILNKKSGLL
GLSTISSDMRDLLAVYDTNDHARLAIKVFVNRIVKYVGQYIAEMGGVDALVFTAGIGENS
APIRQMIADKLAYFGVALDEAANQKRGEEIDISAKDARVKTLVIPTNEELMIARDVELFK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaacaatggctgtaaatgctggtagttcttcattgaaatttcaattattagaa
atgccggcagaacaggtacttgcacaaggattgatcgagcggattggcatggatgatgcc
attgtgacgattaagtacgacgccaaagcgatgaatcaaggcggacgcttggacgatcag
tcggtggatgacagcaatattacaatttcgaaagatgggcaaacacgaaaatatgaaact
gttttgccaatcaaagatcatcaacaagccatcaactttatgctacaaaaattaactgat
ttgggcattatcgttgatttcaatgaaattactggtgttggacaccgtgtcgtggcaggt
ggtgagtggtttaatcattctgttaaagtgacaaaggcggtcttggaaaagattgatcgt
ctagcggattatgcccctttgcacaatccggcgaatgctatgggcattcgggcctttcaa
aagttattaccagatgctgtttcagttgctgtgtttgatacttctttttatcaaacgatg
cctgaagaaaattatttatatgcgataccgtatcagtattacacacgttatggtgcgcgt
aaatacggtgcgcacggcacatcgcatcgctatgttgccaatcgcgcggctgacatgtta
cgacaaccacttaaagatttgaaggtcatcacgatgcacttaggtgctggcgattccatt
acggcagtgaaagatgggaaagcattggatacgtcaatgggcttcacgccactagctggt
gtggcgatggctacgcggtctggggatgtcgatacgtcgttgatttactatattcaagaa
cgtgaaggtctaacaaacgaccagatgttgaacatcttaaataaaaagtctggcttgtta
ggattatcaacgatttcgtctgatatgcgcgacttattggcagtttacgataccaatgac
cacgcacgattagcgattaaagtattcgtgaatcgcattgtcaaatatgttggtcaatat
attgccgaaatgggtggtgttgatgccttagtctttactgcgggtattggtgaaaattca
gccccaattcgtcaaatgattgccgataagttagcctatttcggggtggctttggatgaa
gcggccaaccaaaaacgcggcgaagaaattgatatttctgccaaagatgctcgggttaaa
acgttggttattccgacgaacgaagaattaatgattgcgcgcgatgtggagttattcaag
taa

DBGET integrated database retrieval system