KEGG   Leuconostoc gelidum JB7: C269_01025Help
Entry
C269_01025        CDS       T02322                                 

Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lge  Leuconostoc gelidum JB7
Pathway
lge00071  Fatty acid degradation
lge00072  Synthesis and degradation of ketone bodies
lge00280  Valine, leucine and isoleucine degradation
lge00310  Lysine degradation
lge00362  Benzoate degradation
lge00380  Tryptophan metabolism
lge00620  Pyruvate metabolism
lge00630  Glyoxylate and dicarboxylate metabolism
lge00640  Propanoate metabolism
lge00650  Butanoate metabolism
lge00900  Terpenoid backbone biosynthesis
lge01100  Metabolic pathways
lge01110  Biosynthesis of secondary metabolites
lge01120  Microbial metabolism in diverse environments
lge01130  Biosynthesis of antibiotics
lge01200  Carbon metabolism
lge01212  Fatty acid metabolism
lge02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C269_01025
   00630 Glyoxylate and dicarboxylate metabolism
    C269_01025
   00640 Propanoate metabolism
    C269_01025
   00650 Butanoate metabolism
    C269_01025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C269_01025
   00072 Synthesis and degradation of ketone bodies
    C269_01025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C269_01025
   00310 Lysine degradation
    C269_01025
   00380 Tryptophan metabolism
    C269_01025
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C269_01025
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C269_01025
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C269_01025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lge04147]
    C269_01025
Enzymes [BR:lge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C269_01025
Exosome [BR:lge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C269_01025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFS39652
UniProt: J9YEB5
Position
209458..210606
Genome map
AA seq 382 aa AA seqDB search
MNHIIPRASIVSAKRLPIGKVNGIFAHQTPEVLFQSLISQQLADLPGYSKEQIDQVILGN
VTNQGGNLARRCALAAGFPVETPAFTVDSQCASGLVAVASGVQTIISGQSALVLAGGIES
TSLANMTINRDTNAVLRRFPMVPAGQLDLDMGIVAENMTQKYHVSREQQDAYALKSHQKA
KQAFEMGLLNRECYAFKAENIKYMQDQCPRFDTNLEKLAQLKSVFSKQGSVTAGNSCPIN
DGAGIVLLKKFDPNDIVQGYYLDHELVGLAPDQFLLGPISATRKLLVKHRLSITDIDVIE
MNEAFAVQGIICQKALDIQDDQLNPLGGALSYGHPYGATGAILIARLLNSLNQIPKPALG
IVTLCVAGGMGMSMLIGNQHWT
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacataatacccagagcaagtattgtcagtgctaaaagattacctattggtaaa
gttaatggtatttttgcgcaccaaacaccagaagttttattccaaagcttgattagccaa
cagttggcagacttgcctggctattcaaaagaacagattgatcaagttattttgggaaat
gtgaccaatcaaggtggtaacttagcccgccgttgtgccttggcagcaggttttccagtc
gaaaccccagcatttacagtggatagtcaatgtgcttctggtttggtggcggttgcttca
ggtgtgcagacgattattagtggacaatcagcgttagtactagctggtggtatcgaaagt
acgtcactagcaaatatgactatcaatcgtgatacgaacgctgtattaagacgttttcca
atggtgccagctggtcaattagatttggatatgggtattgtagcagaaaatatgactcaa
aaatatcatgtttcaagagaacaacaagatgcatatgctctcaaaagccatcaaaaagcg
aaacaagcttttgagatggggctactgaatcgagaatgctatgcttttaaggcagagaat
attaagtatatgcaagatcaatgccctagatttgatactaatttagaaaaattggcacaa
cttaagtctgttttttctaaacaagggtcagtaacggccggtaatagttgcccgattaat
gacggtgctggtattgtgttactgaaaaaatttgacccaaatgacatcgtgcaaggttat
tatttggaccatgaacttgtgggtttggcacccgatcaatttttattaggtccaatcagt
gccacacggaagctattagttaagcatcgattgtcaataactgatattgatgttatcgag
atgaatgaagcttttgcagtacagggtattatctgtcaaaaggcactagatattcaagat
gatcaattaaatccattgggtggtgccttatcgtatggccatccatatggagcaactggt
gctattttaattgctaggctactcaatagcttgaaccaaatacctaaacctgcgttagga
attgtgacattatgtgttgctggtggtatggggatgagcatgctgatagggaatcaacat
tggacgtga

DBGET integrated database retrieval system