KEGG   Leuconostoc gelidum JB7: C269_04590Help
Entry
C269_04590        CDS       T02322                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
lge  Leuconostoc gelidum JB7
Pathway
lge00030  Pentose phosphate pathway
lge00480  Glutathione metabolism
lge01100  Metabolic pathways
lge01110  Biosynthesis of secondary metabolites
lge01120  Microbial metabolism in diverse environments
lge01130  Biosynthesis of antibiotics
lge01200  Carbon metabolism
Module
lge_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C269_04590
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C269_04590
Enzymes [BR:lge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     C269_04590
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     C269_04590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored NAD_Gly3P_dh_N 2-Hacid_dh_C DUF2585 Shikimate_DH ApbA 3HCDH_N YadA_anchor
Motif
Other DBs
NCBI-ProteinID: AFS40361
UniProt: J9YG77
Position
950842..952269
Genome map
AA seq 475 aa AA seqDB search
MLEADFGVVGLAVMGRNLALNIESRGYNVAVYNRSRERTDDLITKHADKKFVPSYSIASF
VQAIKTPRRILLMVKAGKGTDAVIDELLPQLTKGDMLIDGGNTFFEDTIRRSEKLAQSGI
NFIGMGVSGGELGALQGPSLMPGGQREAYDLVAPVLRKIAARAPEDDQPTVTYIGPNGAG
HYVKMVHNGIEYGDMQLISESYDILKRLLKLDSNNLSSTFAHWNDGELNSYLIEITADIL
TRKDDLGSDKPIVDMILDRAGNKGTGKWSSQSALAVGAPQSLITESVYARYISAMKSDRV
AASKVLSGPEFTFTGDVDAAKEDIRQALYFGKIMSYAQGFDQLRMASNHYNWNLPFGELA
QLWRAGAIIRAQFLQRITDAYSTNHNLHNLLLDTYFKNIAESYQAATRRVVAMAVSAGVP
TPALSAAIAYYDSYRSEVLPANLVQAQRDYFGAHTYERTDKPSGEMYHFSWYDEA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagctgattttggtgttgttggtttggcagtcatggggcgtaatttagcgctt
aatatagaatcacgtggttacaacgttgcagtatataatcgctcacgtgaacgtactgac
gatttgatcacaaagcacgcagataaaaaatttgtgcctagttattcaattgcgtcattt
gtgcaagcgattaaaaccccaagacgtattttattaatggttaaagctggcaaaggaaca
gatgctgtgattgatgaattattgccacaactaacaaaaggagatatgttaattgatggc
ggtaatacttttttcgaagatacaatacgtcgttctgaaaaattagcgcagtctggtatt
aattttattggaatgggtgtttcaggaggagaacttggtgcgttgcaaggcccctcattg
atgcctggtggccaacgagaggcatatgacctagttgcacctgttttacgtaaaattgct
gctagagcacctgaagacgatcaaccgacagttacttatattggccctaatggtgcaggt
cactatgttaaaatggtacataacggtatcgagtatggcgacatgcaactcatttcagaa
tcatatgatattttaaaacgcctgttaaaattggattctaacaatttatcatcaactttt
gctcattggaatgatggcgaattgaactcgtatctaatcgaaattacagctgatattttg
acaagaaaagatgatttaggttctgataaaccaattgtcgatatgattttagacagagca
ggaaataaaggtactggtaagtggtcttcacaatctgcgttggctgttggtgcgccacag
tcattaattacagaatctgtttatgctcgttatatttctgctatgaaatctgatcgtgtt
gcggcctctaaggtgttgtcaggtccagaattcacatttacaggagatgttgatgccgca
aaggaagatattcgccaggcactatactttggtaaaattatgtcttatgcacaaggattt
gatcaattacgcatggcttctaatcactataattggaatttaccttttggtgaactagca
caattatggcgtgcaggggcgattattagagcacaattcttacaacgaattaccgatgcg
tacagtacgaatcataatttgcacaatttacttttggatacttatttcaaaaatattgcc
gagtcatatcaagctgccacacgtcgtgtcgtggcaatggcggttagtgcgggtgtacct
acgccagcactctcagctgctattgcttactatgattcctatcgatcagaagttttgcca
gcaaacttggtacaagcacaacgtgattactttggcgcacatacttatgagagaactgac
aaaccatcaggtgagatgtatcatttttcatggtatgatgaagcttaa

DBGET integrated database retrieval system