KEGG   Leuconostoc gelidum JB7: C269_04925Help
Entry
C269_04925        CDS       T02322                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lge  Leuconostoc gelidum JB7
Pathway
lge00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C269_04925
Enzymes [BR:lge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     C269_04925
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     C269_04925
    1.1.1.-  
     C269_04925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C Pyr_redox_2 2-Hacid_dh_C UDPG_MGDP_dh_N Pyr_redox TrkA_N FtsJ PrmA Titin_Z Pyr_redox_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFS40426
UniProt: J9YGB6
Position
complement(1017708..1018754)
Genome map
AA seq 348 aa AA seqDB search
MKAAVWHGVKDVRVEEVELKPTKSNEVVVRVAYAGICGSDLHEYLEGPVFIPVDQPDELT
GGQAPLTMGHEFSGVIEKIGADVTQYKVGDHVSINPTITKGNVPDDVDVYDGYSFIGLST
DGGFTSHVNVPEDSLYRLPEDFSMKLAATIEPTAVAVQAVKEGGLRFGEKVVIFGAGPIG
VLVAAAAKAAGATKIVAVDLSEVRLNKALEMGATDIVNPSQVNDTVAAIKNIIPGGADVS
FEVAGVQPTFEQAIDATRPRGTMVIVSIFARPITFNPMQLMNAGVKLTTTIAYSKETFQQ
TVDLVSSGQIDVAPVITDTIELDDIVTDGFESLTHDKSQAKIIVDLSK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctgtatggcatggcgttaaagatgttcgcgttgaagaagtagaattgaaa
ccaaccaaatcaaatgaagtggttgtacgtgttgcttatgctggtatctgtggtagcgac
ttacatgaatatcttgaaggtccagtgtttattccggttgatcaaccggatgaactaaca
ggtggtcaagcaccattgacgatgggccatgaattttcaggtgttattgaaaaaattggt
gctgatgttactcaatataaagttggtgaccatgtgtcaattaatccaacgataacaaaa
ggaaatgtacctgatgatgtagatgtttatgatggctacagctttattggtttgagtact
gatggtggattcacttcacacgtcaatgtacctgaagatagcttgtatcgtttaccagaa
gatttttcaatgaaattagcagctacaattgaacctacagcagttgctgttcaggctgtt
aaagaaggtggtctacgtttcggtgaaaaagtagttatatttggtgctggaccaatcggt
gtactagtagctgctgctgcaaaagcagctggtgcaactaaaattgttgctgttgatcta
tctgaagtccgtcttaataaagcgcttgaaatgggggcaactgatatcgttaacccaagc
caagtaaatgatacagtagctgccattaaaaatattattcctggtggtgcagatgtctcg
tttgaagtagctggcgtacaacctacattcgagcaggcaattgatgcaacacgaccacga
ggtacaatggttattgtatcaatatttgcgcgcccaattacatttaacccaatgcaactt
atgaatgctggcgttaaattaacaacaactattgcctattcaaaagaaactttccaacaa
actgttgatcttgtaagcagtggccaaattgatgtggcaccagtaattactgatacgatt
gagctagatgacattgtgactgatggttttgagtcattaacgcacgataaatctcaagct
aaaattatagttgacttaagcaaatag

DBGET integrated database retrieval system