KEGG   Leuconostoc gelidum JB7: C269_06325Help
Entry
C269_06325        CDS       T02322                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lge  Leuconostoc gelidum JB7
Pathway
lge00471  D-Glutamine and D-glutamate metabolism
lge00550  Peptidoglycan biosynthesis
lge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C269_06325
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C269_06325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lge01011]
    C269_06325
Enzymes [BR:lge01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     C269_06325
Peptidoglycan biosynthesis and degradation proteins [BR:lge01011]
 Precursor biosynthesis
  Amino acid ligase
   C269_06325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7 Sial-lect-inser Rad10 Pyr_redox_3 2-Hacid_dh_C Rhodanese
Motif
Other DBs
NCBI-ProteinID: AFS40702
UniProt: J9YGY4
Position
complement(1314310..1315656)
Genome map
AA seq 448 aa AA seqDB search
MKIQDFNNKKVMVFGWARSGKAAAQRLLELGAQVTVVNGGEFEDDIVYRQLLAADVQFIN
HDDAMSLNTTFDYLVKNPGINYETALVKQAEKLNIPILTEVAVALSSFEGRLIAVTGSNG
KTTTTSLIRDMLKSDGQKVTTAGNIGIPVCEVIKNLTADDTLLLELSSFQLMGTPDIRPD
IALITNIFANHLDYHGTRENYVTAKFQLTKNQTTNQLLVLNADGQDTDDFIKKTHAKVVA
FSRIKNEYTVRTDSVDLIISGNHLMPLSDIKLVGPHNLENIVAAVTVAKLAGVHDVAIRH
VLETFGGVKHRLQHVFTDNGVTFYNDSKATDIEATQTALNSFHQPTIWLAGGLDRGDDLM
RLLPNLLHVKAVIAFGETQQKIVTVARAANKPVITVDDVEQAVPVAVKLAVTGDVVLLSP
AAASWDQYKSFEERGERYVTELKKVLGL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacaagattttaacaataaaaaagtgatggtatttggttgggcacgttcaggg
aaagcagcggcacagcgattgcttgaacttggggcgcaagtcactgttgttaatggtggc
gaattcgaagatgacatagtatatcgacaattgttggcagcagatgtccaatttattaac
catgatgatgcgatgtcattaaatactacttttgattatttagttaaaaatccaggcatt
aattatgaaacagcattagttaaacaagcagaaaagttaaacatccctattttgacagaa
gtagcagttgctttgagttcatttgaaggtcgtttaattgctgtgacgggttcaaatggc
aaaacaacaacaacgtcattaattcgagatatgctcaaaagtgatggtcaaaaagtaacg
actgctggtaatataggtattccagtctgcgaggttatcaaaaacttaacagcagatgat
acacttttattagaattatcaagctttcaattaatgggaacgccagatatacggccagat
attgcattaattacaaatatttttgccaatcatttagattatcatgggacacgtgaaaat
tacgtgacggccaagtttcagctaacaaaaaatcaaacaactaaccaattactagtccta
aatgcagatggccaagatacagatgattttatcaaaaaaacacatgccaaagttgttgcg
ttttctcgcataaaaaatgaatatactgtacgtacagatagcgttgatctcattatttcg
ggtaatcatttgatgccgctaagtgatattaaattagtaggaccacataatcttgaaaac
attgtggctgcggtgacagttgcaaaattagcaggtgtgcatgacgtggcaatacggcat
gtacttgaaacatttggtggtgtaaaacatcgtttacaacatgttttcacggataacggt
gtgactttttacaatgattctaaagcgacagatattgaagcgacacaaacagcgttaaat
agttttcaccagccaacgatttggttagctggtggattagatcgtggtgatgatttaatg
agattattaccaaatttattacatgtgaaggccgttattgcctttggtgagacgcaacaa
aaaattgtcactgttgcacgcgctgctaataaaccagttattactgtggatgacgttgaa
caagctgtaccagttgcagtgaaacttgctgtcactggggatgtcgtgttattgtcaccg
gcagctgctagctgggatcagtataaaagttttgaagagcgcggcgaacgttatgtcact
gagttaaagaaagtattggggctataa

DBGET integrated database retrieval system