KEGG   Leuconostoc gelidum JB7: C269_07610Help
Entry
C269_07610        CDS       T02322                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lge  Leuconostoc gelidum JB7
Pathway
lge00330  Arginine and proline metabolism
lge00332  Carbapenem biosynthesis
lge01100  Metabolic pathways
lge01130  Biosynthesis of antibiotics
lge01230  Biosynthesis of amino acids
Module
lge_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    C269_07610
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    C269_07610
Enzymes [BR:lge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     C269_07610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DRE2_N HEM4
Motif
Other DBs
NCBI-ProteinID: AFS40959
UniProt: J9YL23
Position
complement(1584967..1585782)
Genome map
AA seq 271 aa AA seqDB search
MQVVSEKSSSANDWRRIVIKVGTSTIVDASGEIKYPVINRLSQTLTQLQKSGYDIILVTS
GAIGVALQQMKMLKRPTDIPSQQALAAIGQSYLMAIYNQSFAFYQQHVGQVLLTYDVFNN
KQMLQHTIDAIEAMLAQHVIPIINENDVIAVDELDHQHSFGDNDRLAAIVTHETNADGLI
VLSDIDALYTDNPYVNPTAKKIPLVTQVTPELMASASGSSDLGTGGMATKLYAAEYLISK
QRQMILINGKNPATILDVVAGKKIGTLFKGV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtagtgtcagaaaaaagtagctctgccaatgattggcgccgtatagtgattaag
gttggtactagcacgattgttgatgcatcaggtgagattaaatatccagtgattaatcgt
ttgtcacaaacactgacacaattacaaaaatctggatatgacattattctcgtcacttca
ggggcaattggtgtcgctttgcaacaaatgaaaatgctgaaaagaccaacagatattccg
tcccaacaagcattagcagctattggtcaaagttatttgatggcgatttataatcaaagc
tttgctttctatcaacagcatgttgggcaagtattattaacgtatgatgtttttaataat
aagcagatgctacaacatacgattgatgcgattgaagctatgttagcacaacatgtgatt
ccaattattaacgaaaatgatgtgattgcagttgacgagttggaccatcaacattcattt
ggtgataatgatcgcctagcagctattgtcacacatgaaacaaatgctgatggcctcatt
gtattaagtgatattgacgcgttatatactgacaacccttatgtgaatccaactgctaaa
aaaataccacttgttacgcaagtaacgccagaattaatggctagtgccagtggttcatca
gatttaggaaccggtggtatggcgacaaaactttatgctgctgaatatttgatttcaaag
caacgccaaatgatattaattaatggtaaaaatcctgctacgattctagatgttgtagct
ggcaaaaaaatcggtacattatttaaaggagtgtaa

DBGET integrated database retrieval system