KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_104058Help
Entry
LOTGIDRAFT_104058 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00230  Purine metabolism
lgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LOTGIDRAFT_104058
Enzymes [BR:lgi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     LOTGIDRAFT_104058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA HNOB Guanylate_cyc
Motif
Other DBs
NCBI-GeneID: 20229815
NCBI-ProteinID: XP_009051540
JGI: 104058
UniProt: V4AS43
Position
Unknown
AA seq 616 aa AA seqDB search
MYGLLFESIQHFIQLDYGEEAWQQILEHAGIKNMVFTTHKIYRDQIMLDLAASASHVVQD
KTSEEYLGYFGTCFVDFCASYGYDKILRTAGRNYRDFLIGIDNLHETIRFSYPKLKSPSF
IVESEDANGCTLIYRSVRQGYTSYVAGQLSHCAKKFYNVDVKVTLKENVVKNNRTNATFR
LEFDNKGYDHVKKAAICPEYRTVLGATFLKLFPFCILFDEKFVIQHVGESLANLIGNVTK
TKLEDHFSLRRPLFDFTWENILSLQKVIFELEAVNKFELPQNKSSSSKKSSHSKKLLLKG
QMKLLKEWKMVAFLCTPLITNLEDMQKMGLYINDLNMFDNSREMVLKGWHNASQLEHRVD
QQVAASKKIEENLKQQEQWRRKGDLLLYSMMPITIAKRLKNGEDPINTCETFDCVTIMFC
YFVGFDEMCGRASPLQVVEFINNVFIVFDDVVDRHKAFKVETLGDAIYMVAGGVPDRQPG
HTERLANLSLEFVEKASAFKDPLSGTNLQARIGMHIGSIAAGLVGRKTSQYCLFGDTVNT
ASRMQSYGEAGKIHISEPCKEYLQDKGFIIKYRGYLEVKGKGLQTTYWLEGREDEEELHN
KLIQTDLRKYTRKPPR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcttgttatttgagagcatccaacatttcatacaattggattacggcgaagag
gcctggcaacaaattctagaacatgcagggattaaaaacatggtgtttaccacccataag
atttatcgagatcaaattatgttagatttagcagcaagtgctagtcatgtcgtgcaggat
aaaacatcggaagaatatttaggttattttggaacgtgttttgtcgacttttgtgcctcc
tatggatacgataaaatactgcgaactgcagggcgtaactacagagattttctaattggt
attgacaacctacacgaaacaatcagattcagttatcccaaattaaaaagtccgtctttt
attgttgaaagtgaagacgccaacggatgcaccctcatttacaggtctgtgagacaagga
tataccagttacgtagccgggcaactgagccattgtgcaaagaaattttataacgtggac
gttaaagtgaccttaaaagaaaacgtagtgaaaaataatcgaactaatgcaacattccga
ttagaatttgacaataaaggttatgaccacgttaagaaggcagcaatttgtcctgaatat
aggactgtcctgggtgcaacatttttaaagttatttccattttgtatattatttgatgaa
aagtttgttatacagcatgttggtgagagtctagccaatcttattggaaatgttacaaaa
actaaattagaagaccactttagccttagacgtccattatttgattttacttgggaaaat
attttaagtctccagaaagttatatttgaattagaagctgtaaataaatttgaattgcct
caaaataaatctagttcttccaagaaatccagccattccaaaaagcttttactcaaaggg
caaatgaagctcttaaaagagtggaagatggtggcctttttatgcactcctttaataact
aatctagaagatatgcaaaaaatgggattatatataaatgatttaaatatgtttgataat
agtcgagaaatggtgttaaaaggttggcataatgcctcgcaattagaacaccgggttgat
cagcaagttgcagccagtaagaagattgaagaaaatttgaaacaacaagaacaatggcga
cggaagggtgatcttctgttatattctatgatgcctataaccatagctaaacgattgaaa
aatggcgaagatcctatcaatacatgcgagacatttgattgtgtaacgataatgttttgt
tattttgttggatttgacgagatgtgtgggagggcatcaccattacaagttgttgagttt
ataaacaatgtttttattgtatttgatgatgtggttgaccgacataaagcttttaaggta
gaaacattaggagatgctatatatatggtcgctggtggtgtaccagacagacaacctggt
catacagaacgattagctaatctatctctggagtttgtagaaaaagcaagtgccttcaaa
gatccactttctggaactaatttgcaagctagaattggtatgcatataggaagtatagca
gctggtttggtaggaaggaaaacctcccaatattgtttatttggtgatactgttaacaca
gcctcaaggatgcagtcctacggtgaggcaggaaagattcatattagtgaaccatgtaaa
gaatacttacaggataaaggatttattattaaatatcgaggctatctggaagttaaggga
aaaggtcttcaaacaacttattggttagagggcagagaggatgaagaagaattacataat
aaattaatacaaactgatctacgaaagtacactagaaaacctcctaggtag

DBGET integrated database retrieval system