KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_107815Help
Entry
LOTGIDRAFT_107815 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00450  Selenocompound metabolism
lgi00970  Aminoacyl-tRNA biosynthesis
lgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LOTGIDRAFT_107815
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LOTGIDRAFT_107815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lgi01007]
    LOTGIDRAFT_107815
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lgi03016]
    LOTGIDRAFT_107815
Enzymes [BR:lgi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LOTGIDRAFT_107815
Amino acid related enzymes [BR:lgi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LOTGIDRAFT_107815
Transfer RNA biogenesis [BR:lgi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LOTGIDRAFT_107815
 Prokaryotic type
   Other AARSs
    LOTGIDRAFT_107815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e zf-RING_7
Motif
Other DBs
NCBI-GeneID: 20230268
NCBI-ProteinID: XP_009063904
JGI: 107815
UniProt: V3ZXG9
Position
Unknown
AA seq 611 aa AA seqDB search
SVTEEELSAAKKCWRDGVAKLPELRERKHPILPVPGERNIMICSAEPYVNNVPHLGNIIG
CVLSGDAFSRYCRLRNYNSVYLCGTDEYGTATENKALEDGVTPQEICDKYYKLHTEIYDW
FNISFDRFSRTTSTEHTEIVQDIFWKLYNNGYIIKDWVDQLHCDNCNRILADRFVSGICP
LCSYDDARGDQCDGCGKLINAVELINPKCKSCTNIPKVKATQHLFLDLPKLESEFRQHID
KVFDNGIWSQNAKVITNSWIRDGLKPRCITRDLKWGIPVPLEGFTDKVFYVWFEITIGYV
SIAATYTKDWEKWWKNPNEVELIHFLGKDNVPFHSVIFPCTLLGANDNFTLISHMSATEF
LNYEDTKFSKSRGVGVFGDNAQDTGIPADIFRFYLLFVRPEAQDTAFSWDDFLLKNNSEL
LNNLGNFINRGLAFVSSSFNGTIQEINLTSEDLQTVALISRELTIYIQNMEQAKLRDSIR
NVLSISRLGNEMMQVNKPWVLVEGTPDEKARAGSVVSLAANIAWLIGVLLQPYMPSTSEI
ICTQLNGNPKNMVIPTQFIPVLKTGHKIGKPTPLFQKIEASLIEKMKKKFQGKQEKVGRN
DFLSETLCVKY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
tcggtgacagaagaagaactgagtgcagccaaaaaatgctggcgagatggtgtagctaaa
ttaccagaacttagagagagaaaacatccaattttgccagtaccaggggagaggaatata
atgatatgtagtgccgaaccttatgtgaataatgtaccacatctaggtaatattattggt
tgtgtattaagtggtgatgccttttccagatactgtcgactgcggaactataattctgtg
tatttgtgcggaactgatgaatatggtacagcaaccgagaataaagcattagaagatggt
gtaacaccacaagaaatttgtgataaatattataagttacatacagagatctatgattgg
ttcaatatatcttttgatcgttttagccgtacaacttctactgaacacaccgaaattgtt
caagatatattttggaagttatataataatggttatatcataaaagactgggtagatcaa
ttacattgtgataattgtaacaggattttagctgataggtttgtcagtggtatatgtcct
ttgtgtagctatgatgatgctagaggtgatcaatgtgatggctgtggtaaattaattaat
gctgtagaattgatcaaccctaaatgtaaatcttgtaccaacatcccaaaagtaaaagca
actcaacatttatttttagatttacccaagttagaatctgagtttagacaacatatagac
aaagttttcgacaatggtatatggtcacaaaacgctaaagttataactaattcatggatt
cgagatggattaaaaccaagatgtattaccagagacttaaaatggggtataccagtacca
ttagaaggttttactgataaggtattttatgtgtggtttgaaataactattggttacgtc
tctatagctgctacatatactaaagattgggagaaatggtggaaaaatcctaatgaggtt
gagttgattcattttctgggtaaagataatgtgccattccatagtgttatatttccctgt
acattactaggagctaatgataactttacattgataagtcatatgtcagctacagaattt
ttgaattatgaagatacaaagttttctaaaagtcgaggtgtgggtgtatttggtgataat
gctcaagatacaggaataccagctgatatctttagattctatcttctgtttgttagacca
gaagcgcaggacactgcatttagttgggatgattttttgttgaagaataatagtgaactg
ttaaataatttaggaaattttatcaaccgaggactggcgtttgtaagtagcagttttaat
ggcacgatacaagagataaacttaacatcagaagacttacagacagtggctttaattagt
agagaattaactatatatatacagaatatggaacaggcaaaattacgtgattcaataaga
aatgtattaagtatatcaagattaggaaatgagatgatgcaggtcaataaaccatgggtt
ttggtagaaggtacaccagacgaaaaagcaagagcaggatcagttgtaagtttagctgct
aatattgcatggttgattggagtactgttacaaccctatatgccttcaactagtgaaatc
atctgtacacaattaaatggtaaccctaaaaatatggtgataccaactcaatttatacca
gtgttgaaaactggccacaagattggaaaaccgactccgttattccagaaaatagaggcc
tcacttatcgagaaaatgaagaaaaaattccaaggaaaacaggaaaaggtgggtagaaat
gattttctctctgaaactctatgtgtgaaatactga

DBGET integrated database retrieval system