KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_110384Help
Entry
LOTGIDRAFT_110384 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00010  Glycolysis / Gluconeogenesis
lgi00562  Inositol phosphate metabolism
lgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOTGIDRAFT_110384
   00562 Inositol phosphate metabolism
    LOTGIDRAFT_110384
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     LOTGIDRAFT_110384
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     LOTGIDRAFT_110384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 20230583
NCBI-ProteinID: XP_009045495
JGI: 110384
UniProt: V4B148
Position
Unknown
AA seq 282 aa AA seqDB search
VNDELMRFFSLCKKFKDRVENNKTALAEYVNFMNGKEVANVLDKVIGKLGLNKNVLEPFD
LKTMFVICGSELALSKGSPWCDLFDDEDMEVLEYAIDLKKYYKYGPAYKITSDQTCELVS
ELFTVMDDVITVMDRTEDDPDADGFLVGNLMFGHAETLSPLYSTLGIFNDTIPLTAKNFA
QHQNRKFRTSDILPFSANIMIVLYECETNDELVNDEEEYEELGEDYYVQVLVNEKLIKIP
GCAETLCSYNKFREQHLNQIDECHFDEVCGSESDENKMHDEL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgatgaactaatgagattcttttctctgtgtaaaaaatttaaggacagagttgaa
aacaataaaacagcattagcagaatatgtaaactttatgaatggaaaggaagtggctaat
gtcttagacaaagtgattggaaaacttggtctgaataaaaatgtattggaaccatttgat
ttgaagacaatgtttgttatctgtggttctgaattagctttgtccaaaggttcaccgtgg
tgtgatttatttgatgatgaagatatggaagtgttagaatatgctattgatctcaagaaa
tattataagtatggaccagcgtataaaataaccagtgaccagacgtgtgagctagtatct
gaattatttactgtaatggatgatgttattacagtaatggacaggactgaagatgatcct
gatgctgatggatttttggttggtaacttgatgtttggtcatgcagaaactctatcacca
ctatactcaacattaggaatattcaatgatacaattccactgacagctaagaattttgct
cagcatcagaatagaaagtttaggacttcagatattttaccgttttcagccaatataatg
attgtactgtacgaatgtgaaactaatgatgaactagtcaatgatgaagaggaatatgaa
gaattaggagaagattattatgttcaagttttagtgaatgagaaactcattaaaattcca
ggttgtgctgaaacattgtgctcgtataataaattccgtgaacaacatttgaatcaaatt
gatgagtgtcattttgatgaagtgtgcgggtctgagtctgatgaaaataaaatgcatgat
gaattatga

DBGET integrated database retrieval system