KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_125515Help
Entry
LOTGIDRAFT_125515 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K10891  fanconi anemia group D2 protein
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    LOTGIDRAFT_125515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lgi03400]
    LOTGIDRAFT_125515
DNA repair and recombination proteins [BR:lgi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     LOTGIDRAFT_125515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 NolV
Motif
Other DBs
NCBI-GeneID: 20232506
NCBI-ProteinID: XP_009060534
JGI: 125515
UniProt: V3ZCS3
Position
Unknown
AA seq 1428 aa AA seqDB search
MLLTKANLFWIGILILKTHVQQIHSILQISINLRHFNSVLFNLVSSTKKRKVRDNNYNEK
SVFTELVSTCGIILKDGSANNEISIDQAMFQKNLVVAMKAHETYPETVNELLEGLQNYMS
EDKRFHKVLMPTITSTDCDNARASIQDSVVRILMGVDMLQNDVMNMLLEKLPEFIGDAEY
NGEKLFVPHLLLSQFRWLDRIIDCKKLSKKLIEMISITSLDIQREIITCLPEIIEDSEHA
TVANTLRDVLLEGNQLTVAVLDALSNLNLTSELLLEVRGSVIQTLKSVELEDLPVVIKFL
LQTVTNQDSLEVRQFIGNISDLNIDILYISFYLFQASLQYMSRTSEKDCETLTLDAIKSG
IHFQRTVAEAFIKAIDNVKAAGEQKVLDLFVLLILYNTSRKKTVESLFRNKIRSGCFSEN
FLQSSFSSYSQILRDYFTSILSLCEVLLRSPEPVVSYFACSLYKHCFLYFDSFCKQEIVS
SLVTHIGSGLDSEMDSSLHILVDLVENNLKAMVPFAIFVKGVLDYLDNLSVCQIRQLYSM
LSRLAFYDTDEGGMIQDDLHIIIRKQLSSSNPKYKRMGVIGAIMIVKSMAVSKNDTEELE
DDIFRQVISLLQLVRNSCSNNPQSSALFMDELSSVINKGRLATNIENWISENVTSDFQDD
FVVDIEEGKDWLVPLELSFGLNDEEESAIAIDLLPLIIHTSDRKKSTLPKQPRSPQPLCL
SPHFRLVQICEYKQQDGNLEGIDALIGCPIYTVKRDVIDKISSLSQKEKEIICTTLFYEI
NWFIEMVNGFATQTDAEMKGKVICRLINITDSQRLLEKCLAETTNYIPPLANFDLEDKPQ
NTSTASTFKESKKSTKKQGKKLKGDKVNLDDSDETSRGSTQSEKSQVKDNKENKNKAVVS
LSSYTKYFRELDIHVFTMLTTSLITKSALDSQQNTKLTEELKLQPAQLNFLLEDLVQKLS
HSLLSTTNKRRTFLKTKVDKNIGYSHLDQLSSNEIIANIISLLPSLCDHLEKISSYFQKE
VEDNDGVIDSINMSTDESKYMMCIFKHLLQCFLSVFSWNGFLMHCNNDILKQSLQVLISR
IKTGDSTRTQSTFQELIRGSFKYLQNFSNTILNLESGVLLIKVLIVIAKKYENTELQQKI
ATLACDLLKREWRTVDGEREKGQKHNELLQIVIRTYIVHSEEQLSAIETLTTKGIPELID
ADKNGSSNTFPSLTRNSFAVYFRVIFNQLIDSIKSISPYKQTDTKQSKMDKLIQWNMAVR
IHHVLVNLLKVFDGRAILGTVLKYGRQFVEVFYRQAMPLLDSMFRFHREDVQSILKTFQL
STRTLHHLCGHTKIIKDISLTNQVPLLKKALEAFVYRVMLMLTVNKCPEAFWMGNLKNRD
LQGCEILSQVSEHSSASDGGGQGKGSDEEADDVPDEDDDESEVVSIPF
NT seq 4287 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaacaaaggcaaacttgttctggataggtattttgattcttaaaactcatgtc
caacaaattcattcaatactacaaataagcattaatctaagacattttaattctgttttg
ttcaatttagtttcgagtacaaagaagagaaaggtacgagataacaactacaatgaaaaa
tcagtatttactgagcttgttagtacttgtggtatcatactgaaagatggatcagccaat
aatgaaataagtattgatcaggccatgtttcaaaagaatctagttgttgcaatgaaagca
catgaaacatatccagaaactgtaaatgaattgttagaaggtttacagaattatatgtca
gaagataagaggtttcataaggtattgatgccaactataacaagtactgattgtgataat
gctcgagcttctatacaagatagcgtagttcgtatattgatgggtgtggacatgctacag
aatgatgttatgaatatgctattagagaaattaccagaattcattggtgatgctgagtac
aatggtgagaaattatttgtacctcatctattactgagccagtttcgatggttagatcgt
attatagattgtaagaaattgagtaagaagttgatagaaatgataagtataacatcatta
gatatacagagagaaataataacatgtttaccagaaataatagaagattcagaacatgca
acagtagctaacaccttgagagatgtattattagaagggaatcagttaacagtagctgta
ttagatgcattatcaaatttaaatctgacatcagagttacttcttgaagtaagaggatca
gttatacaaacattaaaatctgtagaattagaagatttaccagttgttattaagtttctc
ttacaaactgtaactaatcaagattccttagaggtgaggcaatttattggaaatatttct
gatctaaatattgatatattatatatctctttttatcttttccaggcttcattacaatat
atgtcaagaaccagtgaaaaagattgtgaaactcttacattagatgccatcaaatcagga
attcattttcaaaggactgtagctgaagcatttataaaggctatagacaatgttaaagca
gcaggagaacagaaagtattagatttatttgtattattaatattatataataccagtaga
aagaaaacagtagaaagtttatttagaaataaaattagatctggatgtttctctgagaat
ttcttacagtcttcattttcatcttattctcaaattttgcgagattattttaccagtata
ctatcattatgtgaagtattattaagatcaccagaaccagttgttagttactttgcatgt
tcactgtataaacattgttttctctattttgattccttctgtaaacaggaaattgttagt
agtttggtaacacatattggaagtggtttagatagtgaaatggattcctcactacatata
ttggttgatttagtagaaaataatctgaaagctatggtaccatttgctatatttgtcaag
ggtgttttagattatttagataatctatcagtatgtcagataagacagttatattctatg
ttaagtcgtttagctttttatgatactgatgaaggtggcatgatacaggatgatttacat
attataataagaaaacagctatctagtagcaatccaaagtataaacgtatgggtgttatt
ggtgctattatgattgttaaaagtatggctgtatcaaaaaatgatacggaagaattagaa
gatgatatatttagacaagttataagtttattacagctagtaagaaatagttgttctaat
aatcctcaatcatcagctttatttatggatgaattgtcttctgttattaataaaggtcga
ctagcaaccaatatagagaattggatatcagaaaatgttactagtgactttcaagatgat
tttgttgttgatattgaagaaggaaaagattggttagtaccgctggagttaagttttggt
ttgaatgatgaagaagagagtgctatagccattgatttattaccattaataatacatact
agtgaccgtaaaaaatctacactaccaaaacaacctagatcaccacaacctttatgtcta
tcaccacattttcgtttagttcagatatgtgaatataaacagcaagatggtaatttagaa
ggaatagatgccttaataggttgtccaatatatactgtgaagagagatgtcatagataaa
atctcctcattatcacagaaagaaaaggaaattatttgtactacattattttatgaaatt
aattggtttattgagatggtgaatggtttcgcaactcaaactgatgctgaaatgaaagga
aaagtgatctgtagattgataaatattactgatagtcaaagattattagagaaatgttta
gctgaaacaacaaactatattccacctttggctaattttgatttggaagataaaccacag
aatacctcaacagcatcaacatttaaggagagtaaaaaatctactaaaaaacagggcaag
aagttaaaaggtgataaagttaatctagatgattcagatgaaacaagtagaggctcaact
caaagtgaaaaatctcaggtaaaagataacaaagaaaacaagaataaagcagttgtatca
ttgtcatcttacacaaaatattttagagaattagatatccatgtttttaccatgttaaca
actagtttaattactaaatcagctctagattctcaacaaaatacaaagttaacagaagag
ttaaaattacaaccagcacagttgaattttttattagaagatttagtacagaaattatca
cactcattattatctacaaccaataaacgacgtacatttctcaaaactaaagttgataaa
aatattggatattctcacctagatcaactatcatctaatgaaataatagcaaatataata
tcattattaccatcattatgtgatcatttggagaagattagttcatatttccagaaagag
gtagaagacaatgatggagtgatagatagtattaatatgtcaacagatgaatcaaaatac
atgatgtgtatatttaaacatttattacaatgttttttatctgtatttagttggaatgga
tttttaatgcattgtaataatgatatattaaaacagagtttacaagttttaattagtaga
ataaagacgggtgattcgactcgaactcagtctacatttcaagaattgattaggggaagc
ttcaagtatctacagaatttctcaaatactatattaaatttagaaagcggtgttttatta
attaaagtattaatagtcattgctaagaaatatgaaaatacagagttacaacaaaaaata
gctactctagcctgtgatttattaaaaagagaatggagaacagtggatggggaaagagag
aaaggacagaaacataatgaattattacaaatagttatcagaacatacatagtacattca
gaggagcagttatcagccatagaaacattaacaactaaaggtataccagagttaatagat
gcagataaaaatggttcttctaatacttttccatcattaacaaggaattcgtttgcagta
tattttcgtgtaatttttaatcagttaatagatagtatcaagtctattagtccttataaa
caaacagatactaaacagagtaaaatggataaattgatacagtggaatatggctgttaga
atacatcatgttttagtcaatttattaaaagtatttgatggtcgtgctattctaggtaca
gtattgaaatatggacgccagtttgttgaagttttctatagacaagctatgccattatta
gatagtatgtttagattccatagagaagatgttcaaagtatattaaagacatttcaactt
agtacaagaacattacatcatttatgtgggcatacaaagatcattaaagatatttcttta
accaatcaagtaccattgttaaagaaagccttagaagcctttgtatacagagttatgtta
atgttaacagtcaataaatgtcctgaagctttctggatgggaaatttgaaaaatcgagat
ttacaaggatgtgaaatattatcacaagtatcagaacatagttcagccagtgatggtggt
ggtcaagggaagggaagtgatgaagaagcagatgatgttcctgatgaagatgatgatgaa
agtgaagtggtcagtattcctttctga

DBGET integrated database retrieval system