KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_137255Help
Entry
LOTGIDRAFT_137255 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
lgi  Lottia gigantea (owl limpet)
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lgi01001]
    LOTGIDRAFT_137255
Enzymes [BR:lgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LOTGIDRAFT_137255
Protein kinases [BR:lgi01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   LOTGIDRAFT_137255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Choline_kinase
Motif
Other DBs
NCBI-GeneID: 20233891
NCBI-ProteinID: XP_009045739
JGI: 137255
UniProt: V4AHH7
Position
Unknown
AA seq 352 aa AA seqDB search
MPRGFQPKKTPISNEYRMTGTVLGLGINGRVVECFHRASGEKFALKVLKDVPKARREVDL
HWRAGLNSKHIVKIMDVFENNYSGQRCLLVVMECMEGGELFTRIQERADSAFTEREAAGI
IRDIASAIAHLHSMEIAHRDLKPENLLYSSKDENTKVLKLTDFGFAKEIAAVKSLQTPCY
TPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGAPISPGMKKRIRNGQYE
FPNPEWSRVSQDAKDLIKGLLKTDPEQRLTIQDVLRTKWISDHTLVPPTPLMSARILQEE
GDVWMDVQEEMTNALATMRVDYDASINIKSLQDSNNPILNKRRKKEESSAAV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcccagggggtttcaaccgaaaaaaacccctatttctaatgaatatcgcatgacaggc
actgttttagggttgggaataaatggaagagttgtcgagtgttttcatcgagcatcaggc
gaaaaatttgccttaaaggtattaaaggatgtaccaaaggcaagaagagaagttgacctt
cactggagggctggcttaaattctaaacatattgtgaaaattatggatgtttttgaaaat
aattattctggtcaaagatgccttcttgtggttatggaatgtatggaaggtggagaatta
tttacaagaattcaagagagagcagactcagcatttactgaaagagaggcagcaggtata
ataagggatattgccagtgctatagctcatttacactcaatggaaatagcacacagagat
ttaaagccagaaaatcttttgtatagttccaaagatgaaaataccaaagttctaaaatta
acagattttggttttgctaaagaaattgctgccgtcaaatcactacagacaccttgctat
actccgtattatgttgctcctgaagtcttaggtccagaaaaatatgataaatcatgtgac
atgtggtcattaggagttataatgtatatattattgtgtggttatccgccattttatagc
aaccatggtgcccctatatctccaggtatgaagaagcgtattcgtaatggtcagtatgaa
tttcctaatccagaatggagtagagtttcacaagatgccaaagatctaattaagggttta
ttaaaaacagatcctgaacagcgcttaacgattcaggatgtattacgtacgaaatggata
tcggatcatacattagtacccccaactcctctcatgtcagctagaatcttacaagaagaa
ggtgatgtctggatggatgttcaggaagaaatgactaatgccttagctacaatgagagta
gattatgatgcctctataaatattaaaagtttacaagattcaaataatcccatcctaaat
aaacggagaaagaaagaagaaagctcagcagctgtttaa

DBGET integrated database retrieval system