KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_141816Help
Entry
LOTGIDRAFT_141816 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00600  Sphingolipid metabolism
lgi01100  Metabolic pathways
Module
lgi_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    LOTGIDRAFT_141816
Enzymes [BR:lgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     LOTGIDRAFT_141816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 20234491
NCBI-ProteinID: XP_009049706
JGI: 141816
UniProt: V4A6Q2
Position
Unknown
AA seq 276 aa AA seqDB search
VINGLMSRDDWQLAIKLPVGCLPGGSGNALCCAINYSAGEPVLHNLLLHSTFILIKHRVI
PMDLVLIQTPTERLYSFLSVSWGIIADIDLESEKYRSIGEARFTFGALKRIIEMNVKKET
EFLTAAAEENEIQIEQEVTVATKILGQPVPAPLLTSLDQPVPDNWISFEDDFVTITAVYQ
THLGSDMLASPESRINDGFIYLIIIRSGISRNALLSLFMSFDEGKHVDSPDVEIIRCLAF
RMEPKEGNIMVDGEHIDLSPIQGQVLPGLSRLMAIQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtaataaatggtttaatgagtagagatgactggcaattagccatcaagttacctgtaggt
tgtttacctggtggttctggtaatgctttatgttgtgccatcaattattctgctggtgaa
ccagttctacacaatttacttttacattcaacattcattctaatcaaacatcgagttatc
ccaatggatcttgtattaattcagacacccacagaaagactttattccttcctgtctgta
agctggggtattatagcagatattgatctagaaagtgaaaaataccgaagtataggagag
gccagatttacatttggtgctctcaaaagaattatagaaatgaatgtgaaaaaagaaact
gaatttctaactgcagctgctgaagaaaatgaaatccaaattgagcaagaagtaaccgtt
gctactaaaattctaggtcaaccagtccctgctcctttgttaacttcccttgatcaacca
gtgccagataattggatcagttttgaagatgattttgttacaataacagcagtttatcaa
actcatttaggcagtgatatgcttgcttctcctgaatccagaataaatgatggatttata
tatttgattataataagatcaggaatttcacgaaatgccttattaagtttatttatgtca
tttgatgaaggaaaacatgtggattctcctgatgtggaaattatccggtgcttagcattc
cgtatggaaccaaaagaaggaaacattatggttgatggtgaacacattgacctttcacct
attcaaggtcaagttctaccagggctttcaagattaatggctatacagtag

DBGET integrated database retrieval system