KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_149387Help
Entry
LOTGIDRAFT_149387 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00040  Pentose and glucuronate interconversions
lgi01100  Metabolic pathways
Module
lgi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LOTGIDRAFT_149387
Enzymes [BR:lgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     LOTGIDRAFT_149387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Eno-Rase_NADH_b THF_DHG_CYH_C
Motif
Other DBs
NCBI-GeneID: 20235480
NCBI-ProteinID: XP_009062043
JGI: 149387
UniProt: V3ZWT8
Position
Unknown
AA seq 243 aa AA seqDB search
MEMSFKGKRALVTGGSRGIGRGISIALAKCGAETVAIGTSQTHLDSLKAECENITTKIVD
LSNWDESRAAIESLGQFDLLVNSAGISKLDKFLEVKPEDFDSVINVNVKALINVSQVVAK
GIMKSDKGGAIVNLSSVASFRGLENHTVYCASKGAVDAITKVMALELGSKIRVNSINPTV
TMTDMGKKAWGDPKVADPVLNRIPTGRFVEVDDVVNAVLFLLSDQAAMLNGVHLPLDGGL
TIH
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggagatgtcttttaagggcaaaagagctttggttacgggtggaagcagaggaattggg
cgaggaatatcaatagctttagctaaatgtggtgctgaaacagttgctataggaacatca
caaactcatttggattccttaaaagcagaatgtgagaatatcaccactaaaatagttgat
ctgtctaattgggatgaatcaagagcagcaatagaaagtttaggacaatttgatctgcta
gttaatagtgctggtatatctaaacttgacaagtttttagaagtaaaacctgaagatttt
gatagtgtaataaatgtgaatgtgaaagctttaatcaatgtatcacaggtggttgcaaaa
gggattatgaaatctgataagggtggagctattgtcaatttatcaagtgtagcttcgttc
cgagggttagaaaaccacacagtttattgtgcttcaaaaggagctgttgatgctataact
aaagttatggcccttgaactgggcagtaagattcgagtgaattctatcaatccaacagta
acaatgactgatatggggaagaaggcatggggagatccaaaggtagcagatcctgtacta
aacagaattccaactggtcgttttgtagaagtggatgatgtagtgaatgctgttttattt
ttactgagtgatcaagcagcaatgttgaatggtgtccatttgccattagatggtggatta
acaatacattaa

DBGET integrated database retrieval system