KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_154978Help
Entry
LOTGIDRAFT_154978 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
lgi  Lottia gigantea (owl limpet)
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lgi01009]
    LOTGIDRAFT_154978
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     LOTGIDRAFT_154978
    3.1.3.48  protein-tyrosine-phosphatase
     LOTGIDRAFT_154978
Protein phosphatases and associated proteins [BR:lgi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    LOTGIDRAFT_154978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT CDKN3
Motif
Other DBs
NCBI-GeneID: 20236481
NCBI-ProteinID: XP_009063734
JGI: 154978
UniProt: V3Z499
Position
Unknown
AA seq 314 aa AA seqDB search
MPDELACKLNKSKSLLVIDCRSAFAFDTKHIQGAVSVSCGGVCKRRLQQGKVSLIDLVTS
KEGRNMYKKKSNKDIIIYDDQTTDTRENPKDTTLNVVINTLFREGKDPFVLKGGLKAFCS
RHSDLCCSTKKHDSIHPLMSPIRSISQPAIDTIIASEVLPFVFLGNERDAANLERLQYHN
IRHVLNVTSQVPLYYEKQGIKYRRIPASDSSQQNLKQYFEEAIEFIDDARQNKRRVLIHC
QAGVSRSATITIAYILKHTKMTMTDVYKFVKGKRPIISPNFNFMGQLMEYERDLNSGEAL
RILQPRLQGIESIV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatgaacttgcatgtaaattgaataaatctaaatccctgttagtgattgactgt
cgctctgcctttgcttttgataccaagcatattcaaggtgctgttagtgtgagttgtggt
ggggtatgcaaaaggcgcttacagcaaggcaaagtgagccttatagacttagtgaccagt
aaggaaggtcggaatatgtataaaaagaaaagtaataaagatattatcatttatgatgat
caaacaactgatacgagagaaaatccaaaagatactactttaaatgttgtcatcaatact
ttattcagggagggaaaggatccatttgttttaaaagggggtttgaaagctttttgtagt
cggcatagtgacttgtgttgtagtaccaaaaaacatgactcaatccatcctttaatgagt
ccgattaggtctatttcacaaccagctatagacacgatcattgcttctgaagtattacca
tttgtgtttcttgggaacgaaagggatgcggctaatcttgagcgcctccagtatcataac
atcagacatgttctcaatgtcacctcccaagtgcctctctattatgaaaaacaaggaatt
aaatatcgacgaattccagcctcagacagtagccaacagaacttaaagcagtattttgaa
gaggccattgaattcattgatgatgctcgtcaaaataaacgccgtgttctcatacattgt
caagctggagtgtcaagatctgccaccataacaattgcttacatattgaaacataccaaa
atgaccatgacggatgtctacaaatttgtgaaaggcaagcgcccaataatttcaccaaat
ttcaatttcatgggacaacttatggaatatgaacgagacttaaatagtggagaagcattg
cgtattttacaacctcgtttacagggaattgaaagtattgtgtga

DBGET integrated database retrieval system