KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_155726Help
Entry
LOTGIDRAFT_155726 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOTGIDRAFT_155726
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lgi04030]
    LOTGIDRAFT_155726
G protein-coupled receptors [BR:lgi04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    LOTGIDRAFT_155726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 DUF3278
Motif
Other DBs
NCBI-GeneID: 20236807
NCBI-ProteinID: XP_009066504
JGI: 155726
UniProt: V3YXB0
Position
Unknown
AA seq 310 aa AA seqDB search
MCVPITTIVGNGVVIIAFFTHRRLRTVTNYFVASLAIADIGVAVFVMPFAIYQQLSNKNW
TLGHTMCLVNTSSDVMLCTISIFHLSCMAIDRYLAICRPFLHERMTKKIVLLMLLACWIL
PLFISFVPIMNEWNLIGIEDYYDCLFPEGAPMCVFVVNIPFSLICSSFAFYVPVVFMIIC
NVKIYMAARHQAMQIRSLDVMGHSKGKGKFKQETKAAKTLGIIMGCFSVCWFPFFIFNVI
DPIIGYKIPYIPWLVALWLGYINSMMNPFLYYYFNRSFKAAFKRIFKCRISTDKRPSSLR
DQRPCLYTPV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgttcctattacaactattgttgggaatggcgtggtgataattgcattttttacc
catcgtcggttacgaactgttactaattattttgtggcgtcgttggctatagccgatatt
ggagtagcagtctttgtgatgccatttgctatctatcaacaactgagtaataagaactgg
acactgggacatacaatgtgcttagtgaatacaagctcagacgtgatgttatgtactatt
tcaatattccatttatcttgtatggcaatagacaggtatctggctatatgccgaccattt
ttacatgaacgtatgacaaaaaagattgttttgctaatgttactcgcttgttggatttta
cctttattcatttcttttgtgccaattatgaacgaatggaacctgattggcatagaagat
tactatgattgtctgtttcctgaaggagctccaatgtgtgtttttgtcgttaatattcca
ttttccctcatctgttcgtctttcgctttttacgttcctgttgtatttatgatcatttgt
aatgtgaaaatctatatggctgccagacatcaggccatgcaaattcgtagtttagatgtg
atgggacacagcaaaggaaaggggaaatttaaacaggaaacgaaagcagccaagacatta
ggaattattatgggctgttttagtgtctgttggtttccattttttatatttaatgtaatc
gacccaataattggctacaaaataccatatattccatggttggtagctttgtggttaggt
tatattaattctatgatgaatcctttcttatattactactttaacagaagttttaaagcc
gctttcaaaagaatattcaaatgccgcatatcgactgataagcgaccatcttcattacgc
gaccagcgaccgtgtctttacactcccgtgtaa

DBGET integrated database retrieval system