KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_157933Help
Entry
LOTGIDRAFT_157933 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K10277  lysine-specific demethylase 8 [EC:1.14.11.27]
Organism
lgi  Lottia gigantea (owl limpet)
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lgi03036]
    LOTGIDRAFT_157933
Enzymes [BR:lgi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone H3]-dimethyl-L-lysine36 demethylase
     LOTGIDRAFT_157933
Chromosome and associated proteins [BR:lgi03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    LOTGIDRAFT_157933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 20237556
NCBI-ProteinID: XP_009048770
JGI: 157933
UniProt: V4AZS8
Position
Unknown
AA seq 464 aa AA seqDB search
MSAFQFTILLSQLLCFFADERIILGKHSREERGLDLIGKFSTPGVFYEHFVKPGVPLLWR
AVLDEPKVKFPAYNYWTDGYFREKFGDEEYNVEVQKKENRDKKSVKMTLTQFLDEYKIKP
IYLIDSLSEKMKEDLSLPSTFQCGGLEKSINDVVMWFSSGGTSSVLHKDPLNNFMCVLEG
SKDFVFINKKYEKEVESVGWVEEGSYSTVDVDNVNRRKFSTLLSLPWVRGHANEGDCIFI
PFGWYHQIRSNGRRNLAVNYWFTHRWWFNHPDCIKSSKFNLTEPLNKYPIASSNEILRFK
MLRPYKDLEYILKDQFLEPDVDKEDREKLFDFINLDRDNVLTWEELYEFDIDEAVLKYHH
VLALDYVRTVEDTGPETEEVMKGGEDQGVEIDEGVVLEEYPHGEDHFKRMHQQILKELKM
VMKTMIQKTARSRMNCEKYYVCMLEFLPLILKLEDCVEVYESAL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttccaatttaccattcttcttagtcaacttctgtgtttctttgctgatgaa
cgaatcatattaggcaaacattccagagaagaaaggggcttggatttaattggcaagttt
tcaacacctggtgtattttacgaacattttgtgaaacctggtgtaccgttactatggagg
gcagtacttgatgaacccaaggtgaagtttccagcctataattattggaccgatggatac
ttcagagagaagtttggagatgaagaatataatgttgaggttcagaaaaaagaaaatcga
gataagaaatcagttaaaatgacactgactcagtttttagatgaatataaaattaaacct
atatatcttattgatagtctcagtgaaaaaatgaaagaagacttgtctttaccatcaact
ttccagtgtggaggtttagagaaatctatcaatgatgttgtcatgtggtttagtagtgga
ggtactagttctgttttacacaaggacccgttaaataacttcatgtgtgttttagagggc
agtaaagacttcgtatttattaacaaaaaatacgagaaagaagtagaatcagtagggtgg
gtagaagagggtagctatagtacagtagatgttgataatgtcaaccgcaggaagttctcc
accctcctgtccctaccctgggtcagagggcatgctaacgaaggagactgtatctttata
ccttttggctggtatcatcagatacgatccaatggtagaagaaacctggctgtgaattat
tggtttacacatcgctggtggtttaaccatcctgattgtattaaatctagtaaatttaac
cttaccgaacctctcaataaatatcccatagcctcatctaatgaaatactgaggtttaaa
atgttacgaccatataaagatttagaatatatactgaaagatcagtttctagaaccagat
gttgataaggaagacagggaaaagttgtttgattttattaacctagacagagataatgta
ttaacatgggaagaattatacgagtttgatattgatgaagctgtattgaaatatcaccat
gtactggctctagattatgtcaggacggtagaggataccggaccagagacagaggaggtg
atgaagggaggtgaagaccaaggtgttgagatcgatgagggggtagtgttggaagaatac
ccacatggggaggatcattttaaaagaatgcaccaacagattctgaaggagttaaagatg
gtgatgaagacaatgattcagaagacagcaaggtcaaggatgaattgtgaaaagtattat
gtttgtatgttggagtttttgcccttgatcttgaaattggaagattgtgtagaggtttat
gaatcagctctttga

DBGET integrated database retrieval system