KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_161772Help
Entry
LOTGIDRAFT_161772 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00360  Phenylalanine metabolism
lgi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lgi00790  Folate biosynthesis
lgi01100  Metabolic pathways
lgi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    LOTGIDRAFT_161772
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LOTGIDRAFT_161772
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LOTGIDRAFT_161772
Enzymes [BR:lgi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     LOTGIDRAFT_161772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT
Motif
Other DBs
NCBI-GeneID: 20238777
NCBI-ProteinID: XP_009055925
JGI: 161772
UniProt: V4AID8
Position
Unknown
AA seq 465 aa AA seqDB search
MDAGICKKAKVDDGLQLTKDIGSGAPVYLEEVQDTEGSTTLLFSLTEKVGALAEALSIFD
THRVNLHHIESRPSVEDSENYQFFVACDNQRGGLKEAIVALKQKCKDLTILSRNPGEQKN
EVFTLVPWFPRKIADLDRFANQILSYGSELDSDHPGFTDSVYRARRKEFADIAFHYKHGQ
PIPRVEYTQDEIKTWGTIFNELTKLYPTRACREYNHVFPLLVDNCGFREDNIPQLEDISE
FLKDCTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHGSKPMYTPEPDICHELLGHAP
LLADPAFAQFSQEIGLASLGAPEDYIQNLATLFWFTVEFGLCRQEGQLKAYGAGLLSSFG
ELQYCISDKPEKREFDPTITAEQKYPVTEYQPVYFVADSFESAKVKLRNYACTIPRAFSV
RYNPYTQNVDVINNKQQIVNLTKVIKGDIDLLEEALVKCRNIPAH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaggtatctgtaaaaaggcaaaagttgatgatggattgcaattaactaaagat
attggaagtggtgctcctgtatatttagaagaagtacaagacacagaaggcagtactact
ctcttgttttctctaacagaaaaagttggagctctagccgaagctttatcgatatttgat
actcatcgagtaaatctacatcatattgagtctcgaccatcagtagaagatagtgaaaat
tatcagttctttgtcgcatgtgataatcagagaggtggtctgaaagaagcaatagttgct
ttgaaacagaaatgtaaagatttgaccattttatcacgtaaccctggggaacagaagaat
gaagtctttactctagtaccatggtttccgaggaaaattgctgatttagatagatttgct
aaccaaatattgagttatggttcagaactggattcagatcaccctggttttacagattca
gtttacagagcaagaagaaaggagtttgctgatattgcctttcattataaacatggacaa
cctattcctcgagttgaatatacccaagatgagattaaaacatggggaactatcttcaat
gaattaaccaaactataccctacgcgtgcctgtcgtgaatataatcatgttttcccacta
cttgttgataactgtggttttagagaggataacataccccaactagaagatatttcagag
tttctaaaagattgtacaggattttcattgagaccagtagctggactgctgtcatctcga
gatttcttggctggacttgcatttcgtgtatttcattctacccaatatattcgtcatgga
tctaaaccaatgtatacaccagaacctgatatttgtcacgaattgttaggacatgcccct
ttattggctgatccagctttcgctcaattttctcaagaaatcggtttggctagtcttggg
gctccggaggactatattcaaaacctggctactctattctggtttactgttgaatttggt
ctctgtcgacaagaaggacaactgaaagcttatggagctggtctcttatcgtcttttgga
gaacttcagtactgtatctctgataaacctgagaaaagggaatttgatccaacaattaca
gctgaacagaaatatccagtaactgaataccaaccagtgtactttgttgctgacagcttt
gaatcagctaaagtaaaattaagaaattatgcatgtaccattccaagagcatttagtgta
cgttataacccatatacacagaatgttgatgtcatcaataataaacaacaaattgtcaac
cttaccaaagtaatcaagggtgatatagacttgttggaggaagctcttgtgaagtgtaga
aatattcctgcacattaa

DBGET integrated database retrieval system