KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_177837Help
Entry
LOTGIDRAFT_177837 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi03040  Spliceosome
lgi04141  Protein processing in endoplasmic reticulum
lgi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    LOTGIDRAFT_177837
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LOTGIDRAFT_177837
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    LOTGIDRAFT_177837
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lgi01009]
    LOTGIDRAFT_177837
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lgi03041]
    LOTGIDRAFT_177837
   03009 Ribosome biogenesis [BR:lgi03009]
    LOTGIDRAFT_177837
   03110 Chaperones and folding catalysts [BR:lgi03110]
    LOTGIDRAFT_177837
   04131 Membrane trafficking [BR:lgi04131]
    LOTGIDRAFT_177837
   03051 Proteasome [BR:lgi03051]
    LOTGIDRAFT_177837
   03029 Mitochondrial biogenesis [BR:lgi03029]
    LOTGIDRAFT_177837
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgi04147]
    LOTGIDRAFT_177837
Protein phosphatases and associated proteins [BR:lgi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     LOTGIDRAFT_177837
Spliceosome [BR:lgi03041]
 Complex B
  Other components
   Prp19 complex
    LOTGIDRAFT_177837
 Complex C
   Prp19-CDC5 complex
    LOTGIDRAFT_177837
Ribosome biogenesis [BR:lgi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    LOTGIDRAFT_177837
Chaperones and folding catalysts [BR:lgi03110]
 Heat shock proteins
  HSP70 / DNAK
   LOTGIDRAFT_177837
Membrane trafficking [BR:lgi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    LOTGIDRAFT_177837
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    LOTGIDRAFT_177837
Proteasome [BR:lgi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    LOTGIDRAFT_177837
Mitochondrial biogenesis [BR:lgi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    LOTGIDRAFT_177837
Exosome [BR:lgi04147]
 Exosomal proteins
  Proteins found in most exosomes
   LOTGIDRAFT_177837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR FGGY_C
Motif
Other DBs
NCBI-GeneID: 20244239
NCBI-ProteinID: XP_009046364
JGI: 177837
UniProt: V4AFV6
Position
Unknown
AA seq 653 aa AA seqDB search
MAKAQAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPENTVFDAKRLIGRKFDDQHVQNDIKHWPFTVVNDNTKPKIQVQYKNELKTFAAEEVS
SMVLTKMKETAEAYLGKKVSDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVTH
HVTEFKRKHKKDISDNKRAIRRLRTACERAKRTLSSSAQANVEIDSLYEGIDFYTTITRA
RFEDLCSDLFRGTLDPVGKAILDSKLQKNQIDDIVLVGGSTRIPKIQKLLKDYFNDKELC
KSINPDEAVAYGAAVQAAILTGDKSEAVQDLLLLDVAPLSLGIETAGGVMTPLIKRNVTI
PTKQTQVFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDI
DANGILNVSAADKSTGKENKITITNDKGRLSKDEIEKMVAEAEKYKNEDENQRTRIAAKN
SLEGYAFNMKTTVEDEKMKDKISEEDKKVIIDKCNDVIAWMDSNQLADKDEYEHKQKEIE
GVCNPIITKLYQASGGAPGGMPGGMPDFGAAGAGAGAAPGGDGSGGPTIEEVD
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcacaggcagtaggaatcgatttagggaccacatactcttgtgtgggtgtt
tttcaacatggaaaagttgaaattatcgccaatgatcagggtaacagaaccacccctagt
tatgttgctttcacagacaccgaacgattgattggtgatgctgcaaaaaatcaagttgct
atgaacccagaaaacacagtatttgatgctaagagactaattggtagaaagtttgacgat
caacacgtacaaaatgacatcaaacattggccatttactgttgtaaatgataacaccaaa
ccaaaaattcaagtacaatacaaaaatgaattgaaaacatttgcagcagaagaagtctca
tcaatggtgttgactaaaatgaaggaaaccgctgaagcttatctgggaaagaaagtatcg
gatgctgttgtcacagttcctgcctatttcaacgattctcaaagacaagccactaaagat
gctggtaccattgctggtttaaatgttttgcgtattatcaacgagcctacagcagctgct
attgcctatggtttagataaaaaggttggaggtgaaaggaatgtccttatctttgatttg
ggaggtggaacttttgatgtatctattttgaccattgaagatggtatctttgaagtgaaa
tctacggctggtgatactcatttgggtggtgaagattttgataacagaatggtcacccat
catgttactgaattcaagaggaaacacaagaaagatatcagtgacaataaaagagctatt
agaagattaagaacagcttgtgaaagagcaaagagaaccctatcctccagtgcacaagct
aatgtagaaattgattctctctatgagggtattgacttttacaccactattaccagagct
aggtttgaagatttatgttcagatctgtttagaggtaccctagatccagttggtaaagcc
atcttagattctaaacttcaaaagaaccaaatcgacgacattgttttagtcggtggatcc
acccgaattcccaaaatccagaagttgttgaaagattactttaatgataaagaattatgt
aaaagcatcaaccctgatgaggctgtagcttatggagcagctgtacaagctgccatctta
actggtgataaatctgaagctgtccaagatctcttattgttggatgtagctcctctttct
cttggtattgaaacagctggtggtgtgatgactccacttattaaacgtaatgtgaccatc
cctaccaaacaaacccaagtgtttactacatactctgacaaccaacctggtgtcctgatt
caagtatatgaaggagaaagagccatgacgaaagacaacaatttactgggtaaatttgaa
ctcagtggtattcctccagccccacgtggtgttcctcagattgaagtaacttttgacatt
gatgctaatggtattctcaatgtatctgctgctgataagagtactggcaaagagaacaaa
atcaccatcaccaatgacaaaggtcgacttagtaaagatgaaattgaaaagatggttgct
gaagctgagaagtacaagaatgaagatgagaaccagagaaccaggattgctgccaagaac
agtttggaaggttatgctttcaatatgaagaccactgtggaggatgagaagatgaaagat
aagattagtgaagaggacaagaaagttatcattgataaatgtaatgatgtcattgcttgg
atggactcaaatcaactcgctgataaagatgaatatgagcacaaacagaaggaaattgaa
ggtgtatgcaatccaattattaccaaactataccaagcatctggaggggctcccggtggt
atgcctggaggtatgccagacttcggtgctgctggagctggtgcaggagctgctcccggt
ggtgatggatctggtgggccaaccattgaagaagtagattaa

DBGET integrated database retrieval system