KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_184756Help
Entry
LOTGIDRAFT_184756 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00510  N-Glycan biosynthesis
lgi01100  Metabolic pathways
Module
lgi_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    LOTGIDRAFT_184756
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lgi01003]
    LOTGIDRAFT_184756
Enzymes [BR:lgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     LOTGIDRAFT_184756
Glycosyltransferases [BR:lgi01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   LOTGIDRAFT_184756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-GeneID: 20244623
NCBI-ProteinID: XP_009044300
JGI: 184756
UniProt: V4BB73
Position
Unknown
AA seq 395 aa AA seqDB search
MINAGMSFLGFLLCLNIIPKFKPMFIEAKLFGIDMSKTSKQKVPEALGVVCGAVFLIILF
LFIPIPFYKHLSTGTEKFPYHEYVEYLAALLSICCMVFLGFADDVLDLRWRHKLLLPTIS
SLPLLMVYFVNFNSTTIIVPQPLRGLLGYDLNLGCLYYVYMGMLAVFCTNAINILAGVNG
LEVGQSWVIGCSVLIFNFIELSGEQRDAHMFSSYFIMPFISVTSALLYYNWYPSQVFVGD
TFCYFSGMTFAVVAILGHFSKTMLLFFIPQILNFIYSVPQLFRFVPCPRHRLPRFNAKTE
KLELSTTKFKYKELSIIGKLLINIYRLVGCIKILDNNEEFMECNNFTLINLAIRYLGPLH
ERTLVSILLIFQIFCSIIAFTIRYQLALLFYEKLS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgcaggaatgtcattcctaggctttctgctctgtctcaacataataccgaag
tttaagccaatgtttattgaggctaaattgttcggaatagatatgagcaaaacatccaaa
caaaaagttccagaagcattaggagtagtttgtggcgctgtatttttaattattttgttt
ttatttataccaataccattttataaacatttatcaactggtactgagaaatttccctat
catgagtatgtagaatatttagctgccttattatcaatatgttgtatggtgtttctggga
tttgctgatgatgtattagatttaagatggcgtcataaactacttctaccaactatatca
tcactgcctttattaatggtttattttgttaattttaattctactactatcattgttcct
cagccattgagaggcttacttggttatgatctcaatttaggttgtttatactatgtttat
atgggtatgttagctgtgttctgtaccaatgctatcaatatattagctggcgttaatggt
ttagaagttggacagtcatgggtcattggttgttctgttttaatatttaatttcattgaa
ctttcaggggaacaacgagatgctcacatgttttctagttattttattatgccgtttatt
agtgttacttcagctttattatattataattggtacccctctcaagtgtttgttggtgat
acattttgttatttttctggaatgacgtttgctgtggtagccatattaggacatttcagt
aaaactatgttgttgttttttattcctcaaattttaaattttatttattctgtacctcag
ttgtttagatttgtaccctgtcctagacatagattaccaagatttaatgccaaaacagag
aaattagaattgagtacaacaaagtttaaatataaagaattgagtatcattggaaagtta
ttaatcaacatctatagactagtagggtgtattaaaattctagataataatgaggaattt
atggaatgtaataattttactttgataaatctggctataagatatctgggtccattacat
gaaagaaccctagtctcaattctactgatatttcaaatattttgcagtattattgctttt
actattcgttatcagcttgctttattgttttatgaaaaattatcataa

DBGET integrated database retrieval system