KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_201667Help
Entry
LOTGIDRAFT_201667 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00350  Tyrosine metabolism
lgi00360  Phenylalanine metabolism
lgi00380  Tryptophan metabolism
lgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    LOTGIDRAFT_201667
   00360 Phenylalanine metabolism
    LOTGIDRAFT_201667
   00380 Tryptophan metabolism
    LOTGIDRAFT_201667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgi04147]
    LOTGIDRAFT_201667
Enzymes [BR:lgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     LOTGIDRAFT_201667
    4.1.1.105  L-tryptophan decarboxylase
     LOTGIDRAFT_201667
Exosome [BR:lgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOTGIDRAFT_201667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 20245481
NCBI-ProteinID: XP_009050823
JGI: 201667
UniProt: V4AMV3
Position
Unknown
AA seq 476 aa AA seqDB search
MDAEEFRKRGREMIDYVADYLSNIESRRPMPDVEPGYMKTLIREDAPVEPDQWEDVMKDI
EPIIMKGVTHWHNPNFHAYFPTANSYPAILGDILSDGIACIGFSWAASPACTELEVHMMN
WLGKMLNLPKEFLFSPGGHGGGVIQSTASEVTLTCLLSARTKIINQFKKNNPSIEEGEVI
SKLICYTSSEAHCSVEKAGLIGAVKMRILEPDEKGSLRGVTLEKAIKEDKAKGLVPFFIC
ATLGTTGCCAFDNIKELGPICEKEDIWMHIDAAYAGSSFICPEYRPLLDGVEHAMSFNFN
PHKWLQVTFDCSTLYFRVKDSRLLAGAFVVDPLYLKHDTEGEMPDYRHWHIPLGRRFRSL
KLWFVLRLFGQKKLQAQIIQDIKLAKEFEKLVLEDKRFEISFDVIMALVCFRLKGTNEIN
EKLLKLISEDGRIHIVPSNFKEKYYLRFAVCATSTTSEHVQFAWKVITEMTDKLKV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggatgccgaagaatttagaaaacgcggacgggaaatgattgactatgtagctgactat
ctgtctaatattgaaagtcgacgaccaatgccggatgttgaacctggttacatgaagacg
ctgatccgcgaggatgctcctgtggaacccgaccaatgggaagacgttatgaaggacata
gaaccaatcattatgaaaggagttacacattggcacaatccaaatttccacgcctatttt
cctacggctaactcttatcctgctatattgggagatattctcagtgatggtattgcctgt
attggattttcatgggcagccagcccagcttgtaccgagctagaagtacacatgatgaat
tggctaggaaagatgctgaatttacccaaagagtttctgttcagcccaggcggtcatggt
ggcggtgttatacagtcgacggcgagtgaagtaacgttaacctgtttgttgtcagctaga
accaaaattattaaccagttcaagaaaaataacccgagcattgaggaaggggaagtcatc
tcaaaattaatttgctacacttcatctgaggcccattgttcagtggaaaaggccggttta
ataggtgctgttaaaatgaggattttggaaccagacgagaaaggcagtctaaggggagta
actctagagaaagccattaaagaagacaaagccaaaggccttgttcctttcttcatctgt
gctactttaggtacaacaggctgctgtgcattcgataatatcaaagaacttggtcctatc
tgtgaaaaagaagatatctggatgcatattgatgctgcttatgctggaagttcttttatc
tgtccagaatacagaccactgttagatggcgtcgagcatgccatgtcatttaacttcaat
ccacataaatggttacaagttacatttgattgttcaactttatatttcagggtaaaggat
agtcgattattagccggggcattcgtagtggatccattgtatctcaaacatgacacagaa
ggggagatgcctgactacaggcattggcatataccattaggacgtcgatttagatcatta
aagttatggtttgtattgaggttattcggtcagaagaaattacaagcacaaattatacag
gatatcaaactagctaaagaatttgaaaaattagttttagaagataaaagattcgaaatc
tcatttgatgttataatggcgctagtttgttttaggttaaagggcacaaacgaaatcaat
gaaaaactattaaaattaatcagcgaggatggaagaatccatattgtgccatcgaacttc
aaggaaaagtattacttacgttttgccgtttgtgctacgtccactacgtcagagcacgtt
cagtttgcctggaaagtgatcacagaaatgactgataaactcaaagtataa

DBGET integrated database retrieval system