KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_206927Help
Entry
LOTGIDRAFT_206927 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOTGIDRAFT_206927
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lgi03032]
    LOTGIDRAFT_206927
   03036 Chromosome and associated proteins [BR:lgi03036]
    LOTGIDRAFT_206927
   03400 DNA repair and recombination proteins [BR:lgi03400]
    LOTGIDRAFT_206927
Enzymes [BR:lgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     LOTGIDRAFT_206927
DNA replication proteins [BR:lgi03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     LOTGIDRAFT_206927
Chromosome and associated proteins [BR:lgi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    LOTGIDRAFT_206927
DNA repair and recombination proteins [BR:lgi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     LOTGIDRAFT_206927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2 Cript
Motif
Other DBs
NCBI-GeneID: 20245944
NCBI-ProteinID: XP_009061157
JGI: 206927
UniProt: V4BHH9
Position
Unknown
AA seq 987 aa AA seqDB search
MSDSSTCPFKAEYAKSDRSSCKACKTKIGKDSLRLAVMVQSPHFDGKVPNWFHYSCFWRR
AGDVEQVDDIHGYHTLRWEDQQKLKSRISGETTATDDVDGKIEEHDLLSFRTEYAKSNRS
QCQSCRTKIDQGEVRISCKEVDDPKYGAVDKWYHVDCFVQNRDELNFNFDVKLLPGLRRL
KKPDQEELHKKLAPKSGKKRKADGAAGSSKKVKVEETDEEKLLRTQSAEVWKYRDLLQKN
VNNQAMKLLLELNKQHVPVGESKLLDAMSDALVFGALEPCSECKDGAFFYTPEGYKCAGN
MTGWTKCMNIVRNPKRRAFKIPPEFHDVEFLKKYKYKANIRVFPTIHVSSLETAMDSVDG
AVSNDKPLDQMKFAIIGKTKKSKAVLTKEIANLGGTVVSKIDNTIAACISTKTDVAKKSK
NVKEAEKADVHVVDEEFLDNLKSDTVVANILKHALSSWGSDPQTRIGDIKPKVVKRKMYK
SGMSEMEEMRYKKDVPTKKKMTVKGGAAVDPDSELEDVAHVIQDDKKGILSVVLGLVDIV
KGTNSFYKLQALEKDNNKQWYLFRSWGRVGTNIGGNKIEKMSKKENAIIAFRDLYLEKTG
NSWEDRDSFVKHPNKFYPLEIDYGQEDEKIQSLDSSREGSKLPKPVQDVVCAIFDIDQMK
KAMIEYEIDMKKMPLGKLSKRQIEQAYSVLTELNGLIEKKGSQSLFLDASNRFYTLIPHD
FGMKKPPLLDDPEIIKTKTEMLDSLLEIEVAYNLLKSGDTGANPIDVHYKQLKCKMEPME
KKSEMYKRLSKYVKNTHATTHNQYGLEVLDIFEIDREGEEEKYQPFQDLHNRQLLWHGSR
TTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCRTTQVDNVAYMLLCEVA
LGNTYDLLGSKFIHSLPKGKHSTKGCGMTAPDEAGAFVTDDGCKIPMGQGKDASIGRSSL
LYNEYIVYDTSQIRMKYMLKMKFNYKW
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgtcggattctagtacatgcccgtttaaggctgagtacgctaaaagcgaccgatctagc
tgtaaagcatgcaaaacaaaaataggcaaagattctctgcgtttagcagtcatggtgcaa
tctcctcattttgatggaaaggttcctaactggtttcactattcttgcttctggagacga
gctggtgatgtggagcaagttgatgatattcatggataccatacactccgttgggaagac
cagcagaagctgaaaagtaggatatcaggagaaactactgccacagatgatgtagatggc
aagattgaagaacacgatcttttatcatttcgcactgaatatgccaaatccaatcgcagt
caatgtcaatcatgtaggaccaagattgatcaaggtgaagttcgtatttcatgcaaggaa
gttgatgatcctaaatatggtgcagtagacaaatggtatcatgttgattgttttgtacag
aacagagatgaacttaacttcaactttgatgtcaaacttttacctggtttgagacgatta
aaaaaaccagatcaagaagaactgcataagaaactggctccaaagtctggaaaaaagagg
aaagcagatggcgcagctgggtcctctaaaaaggttaaggtggaggaaactgatgaagaa
aaactgctgcggactcaaagcgctgaagtgtggaaatatcgcgatttattacaaaagaat
gtcaacaaccaggcgatgaagttgttgttggaattgaacaaacagcatgttcctgttggt
gaaagtaaactattagatgccatgtcagatgctcttgtatttggagctctggagccatgt
agcgagtgtaaagatggcgctttcttctacaccccagaaggatacaaatgtgctggtaac
atgactggatggactaagtgtatgaatattgtaagaaatccaaaacgtcgagcatttaaa
atcccgccagagtttcatgatgtggagtttttaaagaaatacaaatataaagcaaacatt
cgtgtgtttcctaccattcatgtttcttctctcgaaactgccatggattctgttgatggg
gcagtttcaaatgataagccgctagatcaaatgaaatttgccatcattggcaaaacaaag
aaatcaaaagcagttttgacaaaagaaattgcaaatttaggaggcactgtggtgtctaaa
attgacaataccatcgctgcatgtatttctactaaaacagacgttgctaagaaatctaag
aatgtgaaagaggcagagaaagctgatgttcatgttgttgatgaagaatttttagataat
ttgaaatctgacactgttgttgcaaatattctcaaacatgctttatcatcgtggggttca
gacccacaaactcgtattggagacatcaaaccaaaggtggttaagaggaaaatgtataag
agtggaatgagtgagatggaagaaatgaggtataagaaggatgtccctacaaagaaaaaa
atgactgtgaagggtggtgctgcagtagatccagactcagagctggaggatgtagctcat
gttattcaagatgataaaaagggcattttgagtgttgttttaggtcttgttgatattgtg
aagggtactaactctttttataaactgcaagctttagagaaggataacaataagcaatgg
tatcttttccgatcttggggacgagttggaactaatattggaggtaataagatcgaaaag
atgtcaaagaaagaaaatgctatcattgctttcagagacttgtatttagaaaaaactggc
aactcatgggaggatagagattctttcgtcaaacatccaaataaattctatcctttagaa
atagattatgggcaagaagatgaaaaaattcaaagtcttgattcttcacgtgaaggctcc
aaattaccaaaacctgtccaggatgtcgtctgtgccatttttgatattgatcagatgaaa
aaagcgatgattgaatatgaaattgacatgaagaagatgcctcttggaaaattatcaaaa
cgacagattgagcaagcttattctgttttaactgaattaaatggattgattgagaaaaaa
gggtctcagagcctgtttcttgatgcttctaacagattttacaccttgattcctcatgat
ttcggaatgaagaaaccacctttgttggatgatccagagataattaaaacaaaaacagag
atgttggacagtctactggagatagaagttgcttataacttgttgaaaagtggtgataca
ggggccaatcctattgatgttcattataaacaattgaaatgcaagatggagcccatggag
aaaaaatcagaaatgtataaacgcctgtcaaaatacgtgaaaaacacccatgcaaccaca
cacaaccaatatggtcttgaagttttagacatctttgaaattgatcgagagggagaagaa
gaaaaatatcaaccctttcaagatttgcacaatcgacaacttctgtggcatggttccaga
acaacaaattacgctggtattttatcacaagggttgcgtattgctccccctgaagccccg
gtcacagggtacatgtttggtaagggtgtctactttgcagatatggtatcaaaaagtgcc
aactattgtcgcacaacacaggtcgataatgttgcttacatgttactttgtgaagtagca
ttaggaaacacctatgatcttctgggtagcaaatttatccactctctacctaaaggcaaa
cattccacaaaaggatgtggtatgacggcgccagatgaggcaggagctttcgtcactgat
gatggctgtaagattccaatgggtcaaggtaaagatgcttctattggacgttccagttta
ttatacaatgaatacattgtctatgatacctcccagatcaggatgaaatatatgttgaag
atgaaatttaactataaatggtag

DBGET integrated database retrieval system